SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000006861 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000006861
Domain Number 1 Region: 94-212
Classification Level Classification E-value
Superfamily PX domain 4.8e-16
Family PX domain 0.0027
Further Details:      
 
Domain Number 2 Region: 292-346
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 883-914
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000105
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000006861   Gene: ENSFALG00000006573   Transcript: ENSFALT00000006890
Sequence length 938
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603200.1:648272:691002:1 gene:ENSFALG00000006573 transcript:ENSFALT00000006890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSLMASTGKNPSTSTLNTMATYPGCHKVTPRSETPIN
SVSNSLENVLHTSTHSMEESLPKRPSGKHSKVSVEKVELKGLAHKKNERNVEYSFEVLWS
DSSVTLVTKSSAEVTEFISKLSQLYPEENLEKFIPCLAGPDSFYLERNHMDLESDLRYLA
PFPSHVVKNDHVRKFFSTSSPSQQLQSSNPGNPSLYKVGTTLGTSGRPICGVAGIQSSQS
HVQHSAAAAVALPHCSHAAGAGAALGYRSQLEGSSPAMLMSSSPQTPQTQEQNGILDWLR
KLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLNPS
TPSSVTSSGVARVPPTSHVGPIQSIRGNHAAELRVDVDQPAHPLPREGSSSEYSSSSSSP
MGIQAREESSDSAEENERRLELHLDASDKEKPVMLLNHFPSSSARPTAQVLPVQNEAGSG
PAGHHTLPMQMLSPTPSHITPIRMLGSVHKPERGSADMKLLSSSVHSLLSLEERNKVSPG
SRGGIKMEKGFGNAVVDVMSASSPHQPLQVLSGGAESSSPTSTMNFGPRTKVVHASTLDR
VIKPAQQPGLIVETSTAATVTSSTVFHVARPPIKLLVSSSLPTDSAMAGQTSCSSNMQIT
VSPAIINPRTALYTANTKVAFSAMSSVPVAPMQGSFCANSNAASSSSHPSPSFTTMANLP
SCPAPSSSPTLSSGADNNFYSSGGGGGSAGSVPVPNQNHHHHHHQQPPPQPPGCMVCSSC
GCSGNCGSSGMTVSYANYFQHPFSGPSMFTFPFLPFNPLCSNGYINTQQYNSSTTFPVVH
TAYNSGLAPDSVMAGQSTFAVPPMQNFMAGTAGVYQAQGVMGNGNGSGHKKNGNLSCYNC
GASGHRAQDCKQPPMDFNRQGTFRLKYAPPSESLDSTD
Download sequence
Identical sequences U3JVQ7
ENSFALP00000006861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]