SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007373 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007373
Domain Number 1 Region: 174-294
Classification Level Classification E-value
Superfamily TIMP-like 5.02e-37
Family Netrin-like domain (NTR/C345C module) 0.00028
Further Details:      
 
Domain Number 2 Region: 33-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-34
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007373   Gene: ENSFALG00000007068   Transcript: ENSFALT00000007405
Sequence length 296
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603178.1:4406006:4466566:-1 gene:ENSFALG00000007068 transcript:ENSFALT00000007405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVQMTSDANTAGSGFIAKFSAAEPHERGDQYCGGRLEKPSGTFHTPNWPERDYPAGVTC
SWHIVAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEINDAKRIGKYCGDSPPAPILS
EKNELLVQFLSDLSLTADGFIGHYKFRPKKLPTTTAPPTTSTVPATSIVKPTVALCQQKC
KRSGTPESNYCSSNFVITGTVITAVTRAGSLHATISIINVYKEGNLAIQQAGKNMSAKIL
VICKQCPLIRRGLNYIIMGQVDEDGRGKIFPNSFVMSFKTKNSKILNTLKNKTCQN
Download sequence
Identical sequences U3JX69
ENSFALP00000007373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]