SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007583 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007583
Domain Number 1 Region: 1174-1369
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 960-1083
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-32
Family Pleckstrin-homology domain (PH domain) 0.00000174
Further Details:      
 
Domain Number 3 Region: 44-168
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007583   Gene: ENSFALG00000007269   Transcript: ENSFALT00000007615
Sequence length 2001
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603175.1:14146739:14231377:1 gene:ENSFALG00000007269 transcript:ENSFALT00000007615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFRILDCVINHNWSFICNLYCAWNDQTSKNKDGKEQSEAISPSEEEETFSWPGPKTVV
LRRTSQGFGFTLRHFIVYPPESAVQFSFKDEENGNRQGKQRNRLEPMDTIFVKQVKEGGP
AFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSVLELSVMPKDEDILQLLQFTKDV
TALAYSQDAYLKGNEAYSGNAHNIPEPPPICYPRLTSTASVKAPAGDKLPSDFSLGKQQV
SRPVRALAQPERAYRMEIQVPPSPTDIAKSNTAVCVCNETVRTVIVPSEKAVDLPSCRNN
HAGPSHRTEEVRYGLKDQTNLKAWTTSPPSLVSTAIVLPQTPITRPVDTTGTVGKASNYV
VCPEGIPNTRPSTQATESPSVSTNHYSSPTSHQHIDWKTYKTYKEYIDNRRMHMYGSRTI
QERLDSLRAASQNTTEYNQVVPNRTASQVRRRSTSHDRVPQSVQIRQRSVSQERLEEPVL
MKEWPRSASQDTLTSPSVNARNHRARSWDYLSKQGEVLENFHSDNMIADANGDRRKTYKW
TGFTEQDDRRGIYDRSRQHAFHMSLRGQNFPIAPNTYISDNRRTGSRASLPGSHFQKVSP
DIKMLQLSRDSQTPMGVSKSAGVSQERLSLTPARSSRSSSLKNSAPYAAKPSIPLNQGLD
AIASKDQRTVNHLHQSSPLNQQSRIRAEGAPDHKAETGKTIQPSSLAPASAKLVQPTSEC
LTTSDNVDGSIKQKIQGFEREDVRESESLQMDVQGNDKDTVVMRDKTPSGHQTPQPLRHQ
SYILAVNDQEAASDTTCWLPNDARREVHIKRIEERKASSSSPPGDSLASIPFIDEPTSPS
IDHDIAHIPASAVISASASQAPAIATVPPSPASPIPLIRRQLSHDHESIRPGVLDSQPAT
KTERSKSYDEGLDDYREEGKSSIKHVSSLKGIKVPDSQKSSEDSGSRKDSSSEVFGDASK
EGWLHFRQLFTDKGKRVGGSIRPWKQLYVVLRGHSLYLYKDKKEQVTLSEEEQPISINAC
LIDISYCETKRKNVFRLTTSDREYLFQAEDRDNMLAWIKAIQDNSNLNDEDTGVTSRDLI
SRRIKEYSTMMSSSSSKTEPSPKTPRQSLSIRQTLLGTKAEQRTQSPHSPKDETERKLLT
KDETSPPKDKGTWRKGIPSIMRKTFEKKPSAVGTFGVRLDDCPPAHTNKYIPLIVDICCK
LVEERGLEYTGIYRVPGNNAAISSMQEELNKGMTDIDVHDDKWRDLNVISSLLKSFFRKL
PEPLFTNDKYADFIDANRKEDPVERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEK
NKMEPRNLAIVFGPTLVRTSDDNMTHMVTHMPDQYKIVETLIQKHDWFFTEDDAEEPLTA
VQEENTVESQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSAKSKGSWGSGKDQYSKELLV
SSIFAAASRKRKKTKEKPQPSSSEDELDNVFFKKELAEQSRADTAKENTAKGEYEREREI
GRKQRMFVLKEKENSSKKDVNVVKDEKKSLKRENILTEEPSLPYHEKCTKSSNTNCPQTM
QKNNPKMPISQSSSQVEETVSDSGTMLSTSSQASQHRYSCKKVASPEIKHNEFLAADVSS
ITSDYSTTSSTMYLTGLDASMLSPEVQSVTESKGEEADDERSELISEGRPMETDSESDFP
VFATGAAADRLSKGKVPEVAKTSRRNSEESEVSCTEGSSTPKLESRRLFSSHKLIECDTL
SRRKSARHKTDSEGSGDAKSEKDLPTVAKMFDIMKKGRSTSSLATSAKSEADKQEPTWRL
KITDRLKLRLKSSADDMFGVGNQKANSAETAKRKNIRRRHTLGGQRDFAEISVLNAWKAQ
EPSQSRERESELSAVTRLKPKCPAQDLSISDWLARERLRTSTTDLNTGETGKPRLENTNL
AEVSKVELPSSAEMQADEGSSSSSLTLINRTPPSGPFQPPDQVNGENYQNMNKNNFSPAV
DAHPHKLSGTQVVRSRFYQYL
Download sequence
Identical sequences U3JXS9
ENSFALP00000007583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]