SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000007763 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000007763
Domain Number 1 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-41
Family C-type lectin domain 0.00022
Further Details:      
 
Domain Number 2 Region: 936-1078
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-39
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 3 Region: 1208-1351
Classification Level Classification E-value
Superfamily C-type lectin-like 1.56e-38
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 4 Region: 632-778
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-37
Family C-type lectin domain 0.0000163
Further Details:      
 
Domain Number 5 Region: 799-923
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 6 Region: 498-637
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-36
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1086-1209
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-30
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 8 Region: 222-346
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-30
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 9 Region: 22-152
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.81e-27
Family Cysteine rich domain 0.0000832
Further Details:      
 
Domain Number 10 Region: 152-210
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-17
Family Fibronectin type II module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000007763   Gene: ENSFALG00000007434   Transcript: ENSFALT00000007795
Sequence length 1444
Comment pep:novel scaffold:FicAlb_1.4:JH603175.1:17192583:17223744:-1 gene:ENSFALG00000007434 transcript:ENSFALT00000007795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLYLPLIFLLSISTSLQMSGSGIFSIYNEDNKLCAQAQNSSSVITTTCDEHDGFQKFRW
VSPTQLLSVALKLCLGVLAKDDETPVTLEPCNRTNELQWWECRNETLATHGKDLFLNYGK
GKGKKIRLSKASSKGSRWKIHGSADNVCSQRYEEIYTLGGNAFGAPCVFPFKLQGKWYAE
CIPRRDDADSLWCATSSDFDRDHMFGYCPLKDTTHNNFWKKNPVTETRYQINSESLLTWH
QARKSCQQQDAELLSITDLREEMYLLGLTSDLGINAKLWIGLYDALDSGWKWTGGRPFRY
LNWAPGNPSVEPGKICGTFQGRNGKWENQLCDRKLGYICQKRNTSLDSFTIPSGDSKHIK
CPREWVPYAGHCYRIYRTPKIWKEAQSSCRKEDGDLASIHNIEEYSFTVSQLGYKPDDEL
WIGLNDFRVQMYFEWSDGTPVTYTKWHHGEPTHTWNKADCILMKGQDGSWVDSACDMKFG
YICKRKPLAEEAGEAEVTYPGCQKGWMKHGFYCYSLVQLPTTFSGAKKVCEENKGYLATV
RDRYEQAFLTSIIGFKPEKYFWIGLSDVEEHGTFRWASGDPVTFTHWNVGMPGEESGCVA
MATGSSAGLWDVLNCEETNTFLCKHLVEGITPPPPPPTTAPVLFCPEGWQSISQSSFCFK
IFQGGREKMQTWFEARDFCRAIGGDLACIHSEEEQTLITRLERGYIHYSYWMGLSALDSD
AGFTWSDGSPVNFEKWSHGEPNNYDGNEKCGVFTGYLNMNWNDLFCEHMLDFVCQIKKGT
SLKPEPNSTFNYDYVAGEDDWIMYNHKQYYFSKDAMSMERARGFCKKNGGDLVVIESETE
KNFLWKYIFYKDWGNNFYIGLSVSLDRTFRWMDGTSVNYVAWAPNEPNFANNDENCVVMY
THTGTWNDINCGSVELFICERLNDTVRPTVAPTSPPPKGGCMEDWLLFGNKCFKAFGFNE
NDTLTWHAARNNCIDLGGNLATISKKEEQAFLMSLLKDAATDAWIGLNDINQEHTYLWTD
GSPVDYTNWAKGSRSYYSMDDCVFLMKNPIEQAGKWKDEGCKASKSYICQKNSDPKLPHS
QPTPVFGFNSYGDDRYELINYKMSWEKAEKNCRDQSAELASILDPYAESFLWLQILKQGQ
PVWIGLNSNTSGGQYLWSDRRRSRYLNWASGEPNKNKACVYLDVDGFWKTASCNETFLSL
CKQSNELIPSEPPQLPGRCPEPKRGRSWIPFRGHCYYVHTTSEESWPDASMMCIRMGASL
VSIEDSAEMNFLLLYLSPLASDFRKFWIGLFKNIDGEWIWMDRSAVEYVNWEKGEPTVLF
DEHCVDMDVSSGTWRTYYCSVDQNFICKVPKIAEVEPTHDSPFNNASINKPAASSSSSLG
GLIFMLIFVLLAGTGLTLYCFYKRRRDRQMFTAGFDNAIYRGDLGTQESNCLVTNIEENE
QATI
Download sequence
Identical sequences U3JYA9
XP_005040797.1.66865 ENSFALP00000007763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]