SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000008463 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000008463
Domain Number 1 Region: 363-495
Classification Level Classification E-value
Superfamily C-type lectin-like 8.27e-43
Family C-type lectin domain 0.0001
Further Details:      
 
Domain Number 2 Region: 223-354
Classification Level Classification E-value
Superfamily C-type lectin-like 5.64e-36
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 3 Region: 811-946
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-33
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 4 Region: 952-1100
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-33
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 5 Region: 506-640
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-31
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 6 Region: 648-798
Classification Level Classification E-value
Superfamily C-type lectin-like 1.37e-29
Family C-type lectin domain 0.00055
Further Details:      
 
Domain Number 7 Region: 1112-1237
Classification Level Classification E-value
Superfamily C-type lectin-like 1.1e-28
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 1254-1386
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-26
Family C-type lectin domain 0.0086
Further Details:      
 
Domain Number 9 Region: 29-160
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.34e-21
Family Cysteine rich domain 0.0031
Further Details:      
 
Domain Number 10 Region: 160-218
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-21
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000008463   Gene: ENSFALG00000008122   Transcript: ENSFALT00000008501
Sequence length 1468
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603401.1:611462:640519:1 gene:ENSFALG00000008122 transcript:ENSFALT00000008501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPPLRGPLCCLLCSLLGLQLVLGAAHPDSKVFLIYNTGVQSCLETKDSLVRLAEGCNAS
APGQQWKWVSRNRLFNVGAMQCLGVSWHGANATAGLHLLATYECDRESVNMRWSCRGLGE
QLSQHLGARLGNSSLDRGDQAHGSQWRTYGTEEDLCSMPYSEIYTIQGNSHGKPCTIPFK
YDNQWFHECTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDKDHLTNSCYQFN
FQSTLSWREAWNSCEQQGANLLSITEIHEQTYINGLLTGYSSTLWIGLNDLDINGGWQWS
DNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCGIALPYVCKKKPNSTADPFLT
DLWSEVKVDCEPSWQPFQSNCYRLVGEKKSWQEAKKTCLRSGGDLVSIHTLSELEFVTKE
IKQDVEELWIGLNDLKLQMNFEWSDGTPVRFTYWHPFEPNNFRDSLEDCVTIWGPEGRWN
DSPCNQTLPSICKKPGRVSQEKEEDDHGCRKGWKWHSPSCFWLGEDRVPYSDARKMCSDY
SSTLVTITNRFEQAYVSSLIYGWDGEYFWTALQDINETGTFRWLSGDEVMYTHWNRNQPG
YNKGGCVALATGSSMGLWEVKNCSTFKAKYICRQNLGTPVNPELPGPFPTPSLTATCPPG
WSSDPKLRHCYKVFNFEKLQEKKTWIAAQEFCRELGAQLLSLGSYEEEHFVANTLNKIFG
ELEPELHEQHWFWIGLNRRDPAGDQSWRWSDGLGFFYHNFDRSNYDDDDIRSCAVLDLAS
LQWMPMQCEAQLDWICKLPKGADVKEPEITTQGSKEWVKYQEAEYKFFEHHSTWLQAQRI
CSWFQAELTSVHSKDELHFLGQNLKKFSRGQEQHWWIGLHTYENDGRFKWSDGSLLNFVS
WAPGKPRPISKDRKCVYMTASREDWGDQKCMTALPYICKRSNGTAVKPSLPPVPAATSGG
CPQGWLPFLSKCFSFNGHNKDEIVKWPEAKQVCESQGAILATIASPLEQAFITSMLPNIS
FDLWIGLHDAQGEFQWVEEVPLRHTSWAPGEPSGCSSSSPLDEPTNCVVVWHGSPPLFTG
RWDDRSCLEEKHGYVCQRSIDLSLSPAQAPFPASPSGTLFYHNSTYRILQKPLRWHEALL
LCETLNATLATIPNPYSQAFLTQAVSSLRAPLWIGLANDEGGRSYSWLTEENLIYTNWQD
GEPQQITGCSYMDTDGTWCTASCDTKLQGGICQLQTGHSRTHKWSYSGSCPKSLEDSSWI
PFRDHCYTFHMEIALGQKDAMRRCQKVGSTVLSIQDEMENIFVWEHLQAYEGLSKGAWLG
MTFNPKGGTLVWHDNTAMNYSNWGQHDTGPSMLSQNSCYWIQSSNGMWRLGSCTNVTMGV
ICKIPRVEESTFSRAALPENTATIAVVVLSVLALCAVLGVVVFLYKRRQNAERGAFESAR
YSRTTSNPSESAEKNILVSDMEMNEQQD
Download sequence
Identical sequences U3K0A9
ENSFALP00000008463 XP_016159846.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]