SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000009394 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000009394
Domain Number 1 Region: 182-305
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.54e-60
Family Dystroglycan, domain 2 0.000000556
Further Details:      
 
Domain Number 2 Region: 499-601
Classification Level Classification E-value
Superfamily Cadherin-like 9.89e-18
Family Dystroglycan, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000118
Family Dystroglycan, N-terminal domain 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000009394   Gene: ENSFALG00000009006   Transcript: ENSFALT00000009434
Sequence length 897
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603359.1:764232:815036:1 gene:ENSFALG00000009006 transcript:ENSFALT00000009434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMTVGCLLQAPVLGRTWLPVLLLAASAQCHWPSEPAEVVRDWENQLEASLHSALPELREA
VPAVVGIPDSSAVVGRYFRASIPTELIAANGEAVQISEAGKDSLPSWLHWNAESSSLEGL
PLDTDKGVHYISVTTLQPFPNGSYVPQSTNVFSVEVHQEEHSEPQSVRAAVQDTSDTAPF
VCGAEEPVTILTVILDADLTKMTPKQRIELLNRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLSQNSVPNISKVEAPAKEGTMSARLGYPVVGWHIA
NKKPHLPKRMRRQINATPTPLTAIGPPTTAAQEPPTRIVPTPTSPAIAPPTETMAPPVRE
PIPLPRKPTVTIRTRGPIVQTPTLGPIQPTRVAEGTGTASVPIRPTMPGYVEPTAVITPP
STTTKKPRVSTLKPATPSTTDSSTAITRRPTRRPKTPRPTKPPSTTRSPISKLTTASPPS
RVRTTASGLPRPWEPNEPPKLTNHIDRVDAWEGTYFEVKIPSDTFYDKEDTTTDKLQLTL
KLREQQMIEENSWVQFNSTSQLMYGMPDHNHIGKHEYFMYATDKGGLFAVDAFEIHVHKH
PHGDKSPVKFKARLEGDHNAVVNDIHKKIMLVKKLALAFGDRNSSTITVQDISKGSIVVE
WTNNTLPLEPCPREQIRTLSKKIADDSGRPSAAFSNVLQPEFKPLNVSVVGSGSCRHIQF
VPVTKDGRVISEATPTVAAGKDPEKSSEDDVYLHTVIPAVVVAAILLVAGIIAMICYRKK
RKGKLTIEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPE
TTPLNQDTIGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences U3K2Z0
ENSFALP00000009394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]