SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000009961 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000009961
Domain Number 1 Region: 421-530
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-22
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 9-73
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000114
Family SAM (sterile alpha motif) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000009961   Gene: ENSFALG00000009531   Transcript: ENSFALT00000010001
Sequence length 546
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603303.1:832503:862020:1 gene:ENSFALG00000009531 transcript:ENSFALT00000010001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRNVPYRSDVLTWDPDDLAEYFRTLKYKDCEKVVRKHSINGQRFLNMSENDIQKFPKL
RVPILSKLSQEINKNEGRLSFLPKWAQTQKSSDNTGTGYAQDDGGWSSFDDDDDYESPDE
DQEKEDEADYESPTEEPEEAEHDSDGYEPPPSNNDEAHHNVIFPAKSLPSSTDYIDRPST
TRSPHQPPHQPPVPPQRPGPASFGGRSATMPAFPPPPSNDLSRDRNMKPLKPPAPSIDRS
TKPSLDRLAPPYERESPGSGKKPGIPEKPLVSQLRSLGEQLAMMPKPPVPPSDRYERGNP
PPLRKQSPGKQTWPPHKKNEEEEDTALQRPVPQLSLPPYSSNAFPPKSVKPPPKPGFNSI
PVAESKEAFKSLFNSSFKQALTLFLYFSISEGSNSRSPSRGPADMRPPLPIPSRQTVHQT
NTQEDEPQGSLKEEWYVAFLSRPEAEAALRRINKDGTFLVRDSSRKTVTHPYVLMVLYRD
KVYNIQIRYQEQDHLYLLGTSLKGKEEFSSVADIIDHFQRTPLLLIDGKDRGSRNQCMLK
YAAGHF
Download sequence
Identical sequences U3K4K7
ENSFALP00000009961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]