SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010303 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010303
Domain Number 1 Region: 629-844
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-106
Family Thrombospondin C-terminal domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 502-627
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.58e-35
Family TSP type-3 repeat 0.00000432
Further Details:      
 
Domain Number 3 Region: 125-170
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.57e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00086
Further Details:      
 
Domain Number 4 Region: 432-504
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.11e-16
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 5 Region: 364-445
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000131
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 6 Region: 217-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 188-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000010303
Domain Number - Region: 330-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0054
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 8-62
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0554
Family Laminin G-like module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010303   Gene: ENSFALG00000009878   Transcript: ENSFALT00000010343
Sequence length 862
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603206.1:2420390:2456168:-1 gene:ENSFALG00000009878 transcript:ENSFALT00000010343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRMSKAVLRYLKSDGRLNSVIFSNIQLADGKPHAVILWLSGLQQGLSTIELYLDCLQVG
AIEDLPKPFSALSQKVVAAELRTLQEKPQDTLEELKLVTGGTLAEVGNLQDCFLQQIEPV
PQYTGDFNRQLMGQMMQMNQILGEVKDLLRQQVKETTFLRNTIAECQACGLGTVSFPTQL
PRRTKPKCEVNSCFRGVRCLETAEGFQCGPCPEGLTGNGVTCSDIDECRYNPCFPGVRCV
NTAPGFRCETCPPGYTGQTVQGIGLSYAKNNKQVCLDIDECQNGGLGFCVPNSHCINTLG
SYHCGQCKPGYTGDQTRGCQAERSCRNRALNPCSIHARCIDERRGEVTCICGIGWAGDGY
ICGKDVDIDGYPNEELSCSAENCRKDNCRFVPNSGQEDADGDGIGDACDDDADGDGIPNE
QDNCVLVPNVNQRNSDQDIFGDACDNCRNVLNNDQRDTDGDGKGDACDDDMDGDGVKNLL
DNCQRIPNEDQEDTDNDGVGDACDSCPTISNPNQSDVDNDLVGDSCDTNQDSDGDGHQDS
TDNCPTVINSSQLDTDKDGLGDECDDDDDNDGIPDLLPPGPDNCRLVPNPGQEDENGDGV
GDVCESDFDQDTVIDRIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEI
VQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQTEQT
YWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTNDQVRLLWKDPRNVGWKDKV
SYRWFLQHRPQIGYIRARFYEGSDLVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYR
CNDTIPEDFQEFQAQQFGVGDI
Download sequence
Identical sequences U3K5J9
ENSFALP00000010303 XP_016160320.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]