SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010305 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010305
Domain Number 1 Region: 179-510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-111
Family Motor proteins 0.0000000368
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000015
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010305   Gene: ENSFALG00000009881   Transcript: ENSFALT00000010345
Sequence length 1376
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603298.1:1539405:1567294:1 gene:ENSFALG00000009881 transcript:ENSFALT00000010345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCLYECLCEAELEKYYSHFAAFGLQKIDELAQVSMEDYAKLGVHDINDRKRLFQLIRI
IKIMREEGIADLSKQDLKPRGLFIQPQVTSANEEKNSVGEMLGHILPHDSEPIRLTRRDL
NIAGIGTKNDLSCPAVSDDIAPLLGDSEAPIVQRITHISGYNYGLPHSCVRSNTFDKETP
WTEREKIRVCVRKRPLCQREERRGEVNIITVKDKETLLLHEKKEAVDLTQYILQHVFYFD
EVFGESCTNHDVYMRTAYPLIQHIFSGGNATCFAYGQTGAGKTYTMIGNHRNPGLYALAA
KDIFRHLETSPSRKDLLVLISFYEIYCGQLYDLLNERKRLFAREDGNHVVQIVGLREIQV
DCVDHLLEVILKGGKERSTGATGVNSDSSRSHAIIQIQIKDTANRACGRISFIDLAGSER
AADARDSDRQTKMEGAEINQSLLALKECIRALDQEHTHTPFRQSKLTQVLKDSFIGNSKT
CMIANISPSHIATEHTLNTLRYADRVKELKKGIRCSTPITKRRRRARNISPKRIQSTPSL
PPGEKSSPKKVKLGLQHPSGVTKPKAYLTALQPHGVPLTSTPKGIGKGHGYKGNTSTPCF
HHTTPVKGVLRITHPLKKKNDDLSPHSEKSPSMKDFIASAETKESDQHDKYMQNRTPVQC
LKVQTVQPVQKQLAPRDDGSFGDGSLPSDSEQEWGNTFAKQSVEPWAYLPPFQKEREEHL
RLYHQQFQQPPILKQKLNYQPLERFLMQYKPEEIQVKQELSLSPTEVQNKEGMQLEDLDD
SDFSEDSFSPVCSQKSVKRGSTNKCSQHSFFLHEREEGTEEEQKGQKRQDLFFKYAIAMQ
DHGLDCSEGNPKAEESIKNAGCSDTPADWSYDLDVESSPSNTAEKPYCLQEDPACSWRNG
KDFLSDHKEYKSKPRCLVYSSEATSVSEKDASNLYISPVLKSGPPECKEIDLQHDEKEES
LLDKKAALAGGVKWKARKNVVSHSVSSSCSSEFTSELMAPLLLSPLDGEDTTKTEKASSS
QEKPPREKQVLDSGAQSRFEEEGWQCTRSRSLTDSMLELGEQPRHGGRLCALLGSPQASP
KRLLHACGRVKPCCCRLGSASSKQGVRRSLFGGHGPMEASAAASTAGSTTGYSVPRLERE
SGGLCSDSPCREHSGGRRCGADVNQHNNAGNSGKSNSSQGHPAEEINAEIPEKSYAAQSP
SRENSLLLQTKPGLRNEDLTHSEDPSKSLFSDEETGLLKTKLKQSIFAQDTFAADAGFAT
IDNKPIANAKCPSHMSSSSSPSPASEMEKWQREALEKAQQIVIRAHQQQLDEMACLCFKE
ECLINQMSAMDFQNFMTMLDEILVLKLKCVQAMRAQLQLCLSSPGTDTSLQTSPPV
Download sequence
Identical sequences U3K5K1
XP_016160360.1.66865 ENSFALP00000010305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]