SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000010776 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000010776
Domain Number 1 Region: 517-619
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-23
Family PDZ domain 0.0000425
Further Details:      
 
Domain Number 2 Region: 1229-1298
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.57e-18
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000010776
Domain Number - Region: 697-864
Classification Level Classification E-value
Superfamily Tropomyosin 0.00209
Family Tropomyosin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000010776   Gene: ENSFALG00000010302   Transcript: ENSFALT00000010819
Sequence length 1343
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603174.1:18631160:18760460:-1 gene:ENSFALG00000010302 transcript:ENSFALT00000010819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTESSGERSTLRSASPHRNAYRTEFQALKSTFDKPKSDGDQKAKEEGEASQSRGRKYG
SNVNRIKNLFMQMGMEPTESAGAAPKTRGKGGPPSPQRRVRPKEFVEKADGSIVKLESSV
SERISRFDTLHDGPSYSKFTETRKMFERNAHETGHSNRYSPKKEKIISNELPDEWCSSKS
HRGSTDSLDSLSPRTETVSPTVSQLSAVFESTDSHNVVVEKSENNEEYSVTGHYPLNLSS
TVTNISSPAANLEGFSPLKEASTWSAPAKQSTGVMAVESSQQTNTPSTPRQKVSTGTSAG
SKATEEVKKSAEASADSVESSATGQRDLVGVLDSERSVDSCARSKSKTETGVLVQQKERP
EHTEGIFDQPEAAELTRNVASGGDFATDAISDAAESHYDEESEKDGHDDVNNFQSSHVYM
HSDYNVYRVRSRYNSDWGETGTEQDDLDDSDENNCYEPDMEYSEINGLPDEDEIPANRKI
QFSRAPIKVFNTYSNEDYDRRNDEVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGIS
IIGMGVGADAGLEKLGIFVKTVTEGGTAERDGRIQVNDQIVEVDGISLVGVTQNFAATVL
RNTKEKVRFVIGREKPGQVSEVAQLISQTLEQERRQRELLEQHYAQYDADDDETGEYATD
EEDEDMGPVLPGGDMAIEVFDLPENDDMFSPSDVDTSKLAHKFKELQIKHAVTEAEIQKL
KTKLQAAENEKVRWELEKTQLQQNIEENKERMMKLESYWIEAQTLCHTVNEHLKETQSQY
QALEKKYNKAKKLIKDFQQKELDFIKRQEAERKKIEDLEKAHLVEVQGLQARIQDLEAEV
FRLMKQNGSQVNNNNNIFERQTSFGEVSRGDPVENLDTKQVTCLDGLSQDFNEAVPETER
LDSKALRTRAQLSVKNKRQRPSRTRLYDSISSTDGEDSLERKPSHSYSSPMHISKSPLPL
CMRASSPASDSGASSLSPVASSAAISLDNLTANQEEEQHHKGGVLSPYARGDTPLSSPSK
SGHSSEASPLHHPAGRNILQDKDGATSAQAARTTSPTMGHTEKLKRKLADLGAPLRRSSS
KGKKRKEKEAVRVTYGSRTVREMLQKSANTKSLAERSSSLPHCVPFTWYGESGKGSNSSS
NLPSPTSSTEPSSENLSPAKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGFSHSLAL
SSDESLDMIDDEILDDGQSPKHSQCQSRAVHEWSVQQVSHWLMSLNLEQYVSEFSAQNIN
GEHLLQLDGSKLKALGMTSSQDRAIIKRKLKEMKASLEKARKAQEKMEKQREKLRKKEQE
QLQRRSKKTEKCSSDATEGTNEQ
Download sequence
Identical sequences U3K6X2
XP_016151888.1.66865 ENSFALP00000010776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]