SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012030 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012030
Domain Number 1 Region: 62-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-80
Family Protein kinases, catalytic subunit 0.00000197
Further Details:      
 
Domain Number 2 Region: 1020-1078
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.72e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 1090-1211
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000946
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 
Domain Number 4 Region: 1272-1499
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000934
Family WD40-repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012030   Gene: ENSFALG00000011522   Transcript: ENSFALT00000012079
Sequence length 1806
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603183.1:3072504:3254548:1 gene:ENSFALG00000011522 transcript:ENSFALT00000012079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTETTMSGEVRLKQLEQFILDGPTQTNGQCFSVETLLDILICLYDECNNSPLRREKNIL
EYLEWAKPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKLKNADKVFAMKILNKWEML
KRAETACFREERDVLVNGDNQWITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDRLP
EDMARFYLAEMVIAIDSVHQLHYVHRDIKPDNILMDMNGHIRLADFGSCLKLMEDGTVQS
SVAVGTPDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKI
MNHKERFQFPAQVTDVSESAKDLIRRLICSREHRLGQNGIEDFKNHPFFAGIDWDNIRNC
EAPYIPEVSSPTDTSNFDVDDDCLKNSETMPPPSHTAFSGHHLPFVGFTYTSSCVLSDRS
CLRLTAGPPSMDLDASIQRTLEDSLATEAYERRIRRLEQEKLELSRKLQESTQTVQALQY
STVDGPIAASKDLEIKSLKEEIEKLKKQITESGQLEQQLEEASTARRELDDASRQIKAFE
KQVRTLKQEREDLNKELAESSDRLKSQAKELKDAHSQRKLAMQEFSEMNERLTDLHSQKQ
KLARQLRDKEEEMEVVMQKVESLRQELRRTERLKKELEVQAEAAAAEASKDRKLRERSEQ
YSKQLESEVEGLKQKQVGRSPGVSSIEHQQEITKLKADLEKKSLFYEEELSKREMMHANE
IKSLKKELRDAESQQLALKKEIMVLKDKLEKTRRENQSEREEFETEFKQKYEREKILLTE
ENKKLTNELDKLTTMFEKLSMNNRQLEEEMRDLADKKESVAHWEAQITEIIQWVSDEKDA
RGYLQALASKMTEELEALRNSSLGARATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQ
AIQDELNKVKASCISTECKLQESEKKNMELLADIERLKKETEELRSEKANKGRRIDSVEN
FTLSNTPSRDEDSKSHLHSRSRSPSTASEIEPIEVADHPPRSIHTPTMRTAYIGSGLSAP
KPKAHQFVVKSFNTPTKCNQCTSLMVGLIRQGCTCEVCGFSCHVTCADKAPAVCPIPPEQ
TKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAVICDFKLFLYDVAEGKASQPSV
VVSQVIDMRDEEFSVSSVLASDVIHANRKDIPCIFRVTASQLSASSNKCSILILADGENE
KSKWVGVLNELHRILKKNKLKDRSVYVPKEAYDSTLPLIKTTQSAAIIDHERIALGNEEG
LFVVHVTKDEIIRVGDNKKVHQIELIPSEQLIAVISGRNRHVRLFPMAALDGRETEFYKL
AETKGCQAIVSGHVRHGALTCLCVAMKRQVLCYELNQSKTRHKKIKEIQVQGNVQWMSIF
SDRLCVGYQSGFLKYPLHGEGSPYSLLHPDDHTLSFISQQPTDAICAVEISNKEYLLCFS
SVGVYVDCQGRRSRQQELMWPASPSSCCYNAPYLSVYSENAIDVFDVNSMEWIQTIPLKK
VRPLNTEGSLNLLGLETVRLIYFKNKMAEGDELVVPETSDNSRKQMVRNINNKRRYSFRV
PEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPMQRSPYQFPHHH
SRLISSPSNFEHIYHMTVNSAEKFLSYDSIHPAFSPSPRSVLGTPDFVTLRNLRPQESRT
VFSGSVSIPSIAKSRTEPGRSMSASSGLAARSSAQNGSALRREFSGGSYGAKRQPMASPS
DGSLSSGGLDQGSDAPTRDYEREDSDSPRHSTASNSSNLSSPPSPVSPHKTKSLSLESSD
HVSWDS
Download sequence
Identical sequences U3KAH6
ENSFALP00000012030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]