SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012162 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012162
Domain Number 1 Region: 2007-2162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000312
Further Details:      
 
Domain Number 2 Region: 1853-2007
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000148
Further Details:      
 
Domain Number 3 Region: 389-577
Classification Level Classification E-value
Superfamily Cupredoxins 2.73e-46
Family Multidomain cupredoxins 0.0000308
Further Details:      
 
Domain Number 4 Region: 22-210
Classification Level Classification E-value
Superfamily Cupredoxins 1.25e-45
Family Multidomain cupredoxins 0.0000269
Further Details:      
 
Domain Number 5 Region: 1709-1853
Classification Level Classification E-value
Superfamily Cupredoxins 1.75e-41
Family Multidomain cupredoxins 0.0000964
Further Details:      
 
Domain Number 6 Region: 1533-1698
Classification Level Classification E-value
Superfamily Cupredoxins 1.26e-36
Family Multidomain cupredoxins 0.000033
Further Details:      
 
Domain Number 7 Region: 584-723
Classification Level Classification E-value
Superfamily Cupredoxins 7.94e-35
Family Multidomain cupredoxins 0.00019
Further Details:      
 
Domain Number 8 Region: 216-350
Classification Level Classification E-value
Superfamily Cupredoxins 4.13e-33
Family Multidomain cupredoxins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012162   Gene: ENSFALG00000011595   Transcript: ENSFALT00000012212
Sequence length 2167
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603221.1:2697960:2724475:-1 gene:ENSFALG00000011595 transcript:ENSFALT00000012212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVGALCSLLLLCLVEEGISKVRRYYIAAVETTWDYTHSDLLSVLQAPAGILGHTGQHH
PPAGVPPRYRKAVFVEYPDGSFTQPKLKPAWMGLLGPTIRAEVYDTVVITFKNLASRPYN
LHAVGVSYWKASEGAGYEDETSQPEKEGDRVDPGKTYTYVWEIQENQGPTEDDSMCLTHS
YSSNTNSVKDINSGLIGALLVCRPGTLVSDGNEGLQKEFVLLFAVFDEGKSWYSEQGSPA
AAQPQALNGTELHTINGYINGSLPGLTLCLKKQVHWHVIGLGSGPEVHSIFFEGHTFLVR
SHRLSSLEISPATYLTAQTTPGTAGWFRMFCQILSHQQAGMEAFVKVEECPEERLLKMGK
LLNEPEELDYPEEDEEIYHVIQVRSFAKDKPMTWTYYIAAEEMDWDYAPVKPVSLDRNTA
SLYLEPGPQRIGSKYKKVVFVEYEDATFKKRRVSNPQDKGILGPVIKGEVGDQFKIVFRN
LASRPYNIYPHGLTSVRPYYAMRPSQEKDVKDIPIPPGQSFTYSWSLTTEDGPTEADPRC
LTRFYYSSIDPVRDTASGLIGPLLICSKKSMDQRGNQIMSDNMKLVLFSVFDENHSWYLQ
ENIKRFCSDAAHVDTQDLQFYASNVMHTINGFVFDNFQTKLCLNDVVYWYVLSVGAQTDF
LSIFFSGNTFKRNMVFEDVLTLFPFSGETVIMSLEKPGVWTLGCLNPDFRDRGMHAKFTV
SQCQYEQYTDGEDYVYPDGEEVAFEFQPRGFSKRKKSCVNEQLNSITSSSNETEKTRCLT
EHGAVLSNSRISDPSSNGTSFLGTMPNPHDISMSSLPETNYEPVSYEAFLEDEELSKIIS
QDEGFGATPPGEHLVSISGRVHGTVSSKEDQQWLHHAMAAPRDALAGTKNLEAEPQKTTT
HTTSLWDSIAYAAGKAPLQVNRSSIHQNDLEHNLALQDVSSQGNEDKLLKGDGKISFNLY
DSEETISTAPSLSIDHNSSSTLNNPSASPDETEDNRTSHAVVHSHAIESNYSSNDLDARL
EKRLHKVVSQGFYETFEDQNVSVSDKPVQGEIFRDESNSLPMKSGTEKASGLAKGSSLLD
TNDLEPSSYVMTEERDEVILKEVFQDAKELAELDSIAFSESNVVTNDTRPFPNGFLKSSE
QFPRHRVAARSTSGPDWRPKQARSLESRGLGFPNTSSRKPLSDGKTAEQDLASPPPETAV
NKEASKACGPHSPFCITRFKKRSLVSSNTLPQVMVAPQSLEEKSSMVERRLQAGRDAVQA
GEENPEERLSTDRGAQGSREGAQHSRRSLPSQEALGTGAAVSSSERQVLTEAADLASNWD
PVSPGAVVNTGDLHSPALAELQPGRAVVWGAPGSEQAQGRSQTEEETNSVEQLGRFSPEP
QQLKANVTEDHVSGTMSEQSPEGMSLKTAIRENCSLSPSSPSVSNNSTKKPAQNMQDTHG
CQVLGREDVLREIGKTEGQGLGEPMEDGENNSTAGERSHIPADREEQALNNGTHSSPSKT
AKTDYDEYSDTEQTMEDFDMYGEEEHDPRSFQGEIRQYFIAAVEVMWEYGDQRPQHFLKA
ISRRKHSWQYRKVVFREYLDGSFTQPVQRGELDEHLGILGPYIRAEVQDVIMVTFKNLAS
RPFSFHSTLTAYEGTTQQAGVVQPGGLQKYSWKVLPQMAPTTQEFDCKAWAYFSNVDLEK
DLHSGLIGPLIICNHGVLSYVSKRQLAVQEFSLLFTIFDETKSWYFLENVDRNCRPPCQI
QQDSPDFKRNHSFHAINGYVSDTLPGLVMAQQQRVRWHLLNMGSTEDIHSVHFHGQLFNA
RTSQEYRMGVYNLYPGVFGTVEMWPSHAGIWRVECKVGEHQQAGMSALFLVYDLNCRNAL
GLASGSIADSQITASGQYGQWAPRLARLDNSGSINAWSTDRSNAWIQVDLLHPTIIHGIK
TQGARQKFSSFYISQFVVFYSLDGRRWKTYRGNATSTQMLFFGNVDATGVKENRLNPPVV
ARYIRIHPTHYNIRATLRMELLGCDLNSCSMPLGMENRGIPDEHISASSHSANVFSRWTP
ALARLNLQGRTNAWRPKSNSPREWLQVDFGVTKKVTAIITQGAKALFTQMFVKEFAVSIS
QDGVHWSSVLQSGKEKIFKANQDHQSAVTNTLESPLFARYVRIHPRQWHNHIALRIEFLG
CDTQQEY
Download sequence
Identical sequences U3KAV8
ENSFALP00000012162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]