SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012382 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012382
Domain Number 1 Region: 38-504
Classification Level Classification E-value
Superfamily Sema domain 4.58e-132
Family Sema domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 1350-1477,1514-1539
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-18
Family p120GAP domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 953-1035
Classification Level Classification E-value
Superfamily E set domains 1.68e-16
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 4 Region: 852-947
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000103
Family Other IPT/TIG domains 0.0058
Further Details:      
 
Domain Number 5 Region: 1036-1139
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000294
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.047
Further Details:      
 
Domain Number 6 Region: 507-559
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000837
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 806-839
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000262
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 1136-1224
Classification Level Classification E-value
Superfamily E set domains 0.0000406
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012382   Gene: ENSFALG00000011860   Transcript: ENSFALT00000012432
Sequence length 1600
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603292.1:1156574:1571709:1 gene:ENSFALG00000011860 transcript:ENSFALT00000012432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPAMWKWTCLVSHLLLSTTVSPLGRQQPPHPKRPFITFTGEQAEGNFNHLVVDERTGHI
YLGAVNRIYKLSSDLKVLVTHETGPDDDNPKCYPPRIVQTCNEPLTPTNNINKMLLIDYK
ENRLIACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNMDDKL
FIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDFDIY
YIYGFSSGNFVYFLTLQPEMISPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCEKN
GVEYRLLQAAYLSKAGAILARSLGVGPEDDILFTVFSKGQKRKMKSLDESALCIFVLKNI
NDRIKDRLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSSMVRGLP
IFTEDGDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGTSKNTQEYEIVQVVDTGPILR
DMAFSMDHEHLYIMSEKQLTRVPVESCSQHETCSQCLGSGDPHCGWCVLHNTCTRKERCE
RSSEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDG
LVVGSQIQCISPAAKEVPQIITENGDHHIVQLQLKSKETGMTFASTSFVFYNCSVHNSCL
SCVESPYRCHWCKYRHVCTHDPSSCSFQEGRVKMPEDCPQLLQAEKILVPVEVIKPITLK
AKNLPQPQSGQRGYECILSIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINSLPVELTV
VWNGNFNIDNPAQNKVHLYKCGAMRDSCGLCLKADPDFECGWCQGQNQCTLKQHCPAQDS
QWLELSSTKGKCTNPKITDINPVTGPREGGTRVTIRGENLGLEFRDIASHVKVAGVECKP
LVEGYIPAEQIVCEMGEAKPSQHAGFVEICVAECKPEFMARSSQLYYFMTLTLSDLKPKR
GPVSGGTQVTITGNNLNAGSNVIVTFGRQPCLFYRRSTKHIVCNTTASYEGFEKVKVSVR
VDKAKIHQELHYEYVEDPTILRIEPEWSIFSGNTPIAVWGTHLDLIQNPQIRAKHGGKEH
VNNCEVQNSTEMTCQAPALAVDPNHQSELAERPEEFGFILDNVQSLLILNKTNFTYYPNP
IFEVFNPSGILELKPGSPIILKGRNLIPPVAGGNAKLNYTVLVGEKPCAVTVSDVQLLCE
SPNLIGRHKVMARVGGMEFSPGMVYISPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAYKR
KSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTM
RVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRD
RGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWF
TFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDYKTLVL
SCVNPDNVNSPEIPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQASGAR
MILQDEDITTKIENDWKRLNTLAHYQVSVGEAGVGARSPF
Download sequence
Identical sequences U3KBH8
ENSFALP00000012382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]