SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012441 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012441
Domain Number 1 Region: 335-462,698-872
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.53e-51
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 65-189
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-29
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 1082-1146
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.14e-19
Family SAM (sterile alpha motif) domain 0.0027
Further Details:      
 
Domain Number 4 Region: 241-304
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.66e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000798
Further Details:      
 
Domain Number 5 Region: 175-231
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000299
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012441   Gene: ENSFALG00000011916   Transcript: ENSFALT00000012491
Sequence length 1148
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603317.1:1640783:1661028:-1 gene:ENSFALG00000011916 transcript:ENSFALT00000012491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKLVPGDLFSRKTRESVSSLDSDKLAPISPEVGGEESSDSEGEQEDSSHKLIRKVSTS
GQMRSKKSVKEGLLLKQTSSFQRWKRRYFKLRGRTLYYAKDAKSLIFDEVDLSDASVAET
STKNINNSFTVITPFRKLILCAENRKEMEDWITALKSVQKWEIHEATQFNMEHFSGMHNW
YACSHARPTFCNVCREALPGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGIEII
EDEDGVAMPHQWLEGNLPVSARCAVCDRTCGSVRRLQDWRCLWCKAIVHSACKELLGKRC
PLGQYKVSIIPPTALNSIDSDGFWKATCPSTCSSPLLAFVNSKSGDNQGVKFLRKFKQFL
NPAQVFDLMNGGPHLGLRLFQKFSTFRILVCGGDGSVGWVLSEIDALGLHKQCQLGVLPL
GTGNDLARVLGWGSLCDDDTQLLQILEKLERATTKMLDRWSVLTYEAPKQSPSALKEEDN
GDSNIQVQIYHYADSVAFHLAKILESDKHSVVISSAKFLCGTVNDFVAEVGRAYKRATEN
KQEAELMARKCAMLNEKLDSLVRELNEEAQAIMVPEEMAQADVKDQEKAGSFNPSPMPRI
FKSKEQLMLRANSLKKALRQIIEQTEKAVDEQNKQTQAYQGSVGPSKDSSEELSKEEEKL
SSRRDTVTSASSSIILDRPDTFGSLQFPEDPSTLHFSEKCVMNNYFGIGLDAKISLEFNN
KRDEHPKKCSSRTKNMMWYGVLGTKELLQRTYKNLEQRVQLECDGVPISLPSLQGIAVLN
IPSYAGGINFWGGTKEDSNFGAPSFDDKKLEVVAVFGSIQMAVSRVINLQHHRIAQCRVV
KITIRGDEGVPVQVDGEAWIQPPGIIKIQHKNRAQMLTRDRAFESTLKSWEDKQKGESYR
AGARPRLSSQQSMEYLTEEESSLLQQVSRVAETLIARIHEAAKAHKAVEQELAHAVNASS
LALSEALSHKAAGASEFLSRNVAVEVVLSIKELWAETRAFLEGKALDSPQEEEALHGPLS
VLGQELQRLLDIHWLGPIAHSAEEEGASSANKGSFKLRLNIPKPRKEKDKLQKQKANSAL
PDKWSSEEVAAWLEALGLGEYRDIFVRHDIQGSELILLERRDLKDLGITKVGHMKRILQA
IKELSNLP
Download sequence
Identical sequences U3KBN7
ENSFALP00000012441 XP_016153884.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]