SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000012928 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000012928
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily RUN domain-like 1.83e-39
Family RUN domain 0.00063
Further Details:      
 
Domain Number 2 Region: 1481-1594
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 9.94e-28
Family Supernatant protein factor (SPF), C-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 1261-1329
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.78e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 
Domain Number 4 Region: 614-881
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000523
Family Tropomyosin 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000012928   Gene: ENSFALG00000012388   Transcript: ENSFALT00000012980
Sequence length 1596
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603282.1:1365160:1399911:-1 gene:ENSFALG00000012388 transcript:ENSFALT00000012980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATSGESQLQRIIRDLQDAVTELSKEFKEGGEPITDDSVNLQKFSYKLEYLLQFDQKEK
STLLGNRKDYWDYFCDCLAKIKGANDGIRFVKSITELRTSLGKGRAFLRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLNSKMSSDIVGQLYELTDVQFDLASRGYDLDAAWPAFAR
RTLSSLGSSAYLWKPPSRSSSMSSLVSNYLQAQEFPSSPDVNNSLNVEHLESYEEMRLEL
DQAELRQRELQDRIHQLEIENQELQAAVSLQKEQVQVEKEKSNNYSEENSRLTKMITELQ
KQCEVSGSTQSTVHDLQKCLQSLELSAVEQQKEHSTKVAQQLTSKQDCASKLQVSNQELE
TSRALIAVKDLCIDELKAKLSSTEQKNLNLLAKVDAALDEKGQQATAQYDFALQIRALLE
KLQEMEKEKADMQRLNDEHASQLKAAREELLLKEQAQKELESRYSSLTANSKEESEKLIG
SLETVVKEKDALQMALTLKGKEMAELETQVMGSLAQVGSLEKNLEEARKEKEKLEEEYGR
REGALKQESQSQAEQLELQEGRLTKVSQTVCSLQEQNRKLMSEKEHLGQKIKELEQQMEQ
QNSAVSELNEESRKLKAEKENLQQSKKKMEEKLKNLEVSKASLEAEVARLRTSEKQLQSE
IDDTLVSVDEKEKKLRGENKQLDEDLQNARRQSQILEEKLEALHSEYEELKQREETSKES
YASLEAQLKSAKQHSLQIEKSLDTLKESKECIQSQLTEKEVELQGMESQCQQLRAEAERY
RKKAETLEIEKLSVEKTCLHQTKLIESLTSEKESVEKQQLQQAASLEKEAKELAFRLTMS
EEQLEVNRGEVSRLQAEVLDLRVKLQQATDERERMRGELTVAETVLSEQKMLVQQLKEQS
ESLNRNHVQELVQCKEREKKLEKEQERTAHQKAELENNLMNLKEELFKVKRYLESARVEN
EENKDLLQLFKVKQYLESARVENEENKDLLHRTNTDMAELGIQICSLTSEKVDAEEQLAQ
ATERFKELEEQAAEQQEKLNLDISNLREENKSLQEKLEEAQMCATAVPSLQLQLETLKKQ
AQSFQETSQEELSAIKFQMSTEILNYQTKFKAVSEECGKVREQLEEQKRQQHAAEEEITE
LQAANTSLCRKLDEAREQLSESESARLQKEEEVTSLRELLERIQKEADEAKEKILDYTEK
LNKVAADKDSSDQKLFAELDDLTRTKQFLEERLIELIRDKDALWQKSDALEFQQKLSAEQ
RWQGDTEVNHCLDCQREFSWMVRRHHCRMCGRIFCYYCCNNYMVTKLGGKKERCCRACFS
KPRVIVDSTDDSGSSANQEGSPASLESPVSPSERAFVASEASKPPDDAAFDIITDEELCQ
VQESDSLHNESQMERDSLDQSVTDLCVCWAKQLLGALYSLQSPFQVSAFHTIRNSTCNSS
TFDESEDWQVAQDAEICLLKSGEIMMKLPLTVEEIMNFGESNRELFIKSSTYSLIPITVS
EMGLTISWIFSSDPKSISFSVVYQESKDTPLDQCKVLIPMTRCNSHKETIRGQVKVRNAG
IYTLIFDNTFSRFISKRVFYHLAVERPVIYDGSDFP
Download sequence
Identical sequences U3KD24
ENSFALP00000012928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]