SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000013601 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000013601
Domain Number 1 Region: 677-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000204
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 2 Region: 198-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 831-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000234
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 4 Region: 629-679
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.0063
Further Details:      
 
Domain Number 5 Region: 723-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 6 Region: 134-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000725
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 7 Region: 784-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 8 Region: 285-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 321-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 10 Region: 373-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 883-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 12 Region: 939-981
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 13 Region: 987-1035
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 14 Region: 1294-1508
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000013601
Domain Number - Region: 1100-1185
Classification Level Classification E-value
Superfamily Tropomyosin 0.0235
Family Tropomyosin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000013601   Gene: ENSFALG00000013029   Transcript: ENSFALT00000013657
Sequence length 1642
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603195.1:1219496:1230372:1 gene:ENSFALG00000013029 transcript:ENSFALT00000013657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFKTFRPAAMLVERSADFGHTWKVYRYFAYDCAASFPHVPHGPPRRIDDVVCESRYSDI
EPSTEGEVIYRVLDPAIPIQDPYSPAIQNLLRVTNLRVNLTKLHTLGDNLLDSRREIQEK
YYYALYELVMRGNCFCYGHASECAPLSGAPATTNGMVHGRCVCKHHTQGLNCERCEDFYQ
DLPWRPAEGSSTNACRRCDCNEHSRRCHFDMAVFLATGNTSGGVCDDCQHNTMGRRCHLC
KPFYYKDPTKDLRDPAVCQACDCDPEGSLDGGLCDSADDPARGLIAGQCRCKEHVAGPRC
DRCKPGFFGLSANNPQGCQRCQCDPRGTVADGSRCDPVSGECFCKRLVTGHSCKQCLPEH
WGLSHDLPGCRPCDCDVGGARNNLCATGTGQCQCRSHVIGRQCEQVETSFYRINLDHYTY
EAEDARLHQGSVVEREPPPDRPASWTGTGFAHMLEGSWVEFHVSDVPFSTEYDVVIRYEP
QHPEAWQEVRLKVLRPSPVSASSPCGNTIPADDQLSTSLPSGARYVVLSQPICLEQGVSY
TLRLELGCAAAHQDATASVLIDSLVLLPRYSSLEMFIAGDPSSMERRETFERYHCAQPFH
AAGPSPVAEPCSSLLHSLSAILHDGALPCLCDPQGSLSAECQPQGGQCQCKPNVMGRRCH
RCSPGTFGFGPGGCRPCQCSREGSVSTICDSTTGQCPCREGTHGPRCDRCQPGHWGFPVC
RPCQCNGHAENCDPRTGSCLRCRDHTDGERCQRCAAGHFGNPALGSGQHCRPCPCPEGPS
TPRHFAASCYQDSRSQQVVCHCSPGYTGSRCDECAPGYYGDPLQGGRCLPCQCHDNIDVT
DPEACDRRTGQCLRCLYNTAGPRCAECQPGFYGDATRHSCRRCSCNPLGTDPSTCGPQQC
HCDRHSGQCHCLPNVEGQSCDRCSPNFWNLASGKGCQPCACHPQHSLTPTCNQFTGQCSC
RPGFGGQTCTNCQEHHWGDPRQQCRACDCDPRGIASAQCHHSSGHCDCRPGISGVRCDQC
ARGFAGTFPACQPCHPCFGDWDRVVQDLAARTRALAQRASLLQHTGAAGAFEGTFRRLEE
NLATVRDVVAARNTTAATAAHLTHAMEGLRRQIEEATERLTRVEGELTAAQDANFNASHV
LNTVDRGARALNHSLQDLEQRLHTLKTSNFLGAYDSIRQSYEESQEAERQADASTRAVPS
PVSISAATRHRTEQLLASQRDDFNRHNAASRRALMDLAARAQALSLQPLNEKVCGVAGDV
PCAESPCGGAGCRDEDGRRRCGGLSCGGAVSKADSALDRARHAQEELRQAASDMTQLSHK
VAEAKGKANEARLQAQAALDKANQTRARVESSNKELRELISHVKAFLSQEGADPESIEVV
ASRVLELSLPAAPDQIQRLAEEIKTRVRSLASVDAILEQTASDVHKAGQLLQDARRARSW
AEGVRGTAEAVRQALEEARQAQGTAEQALQQAAGDIQHSERALSTMQTQTGGAEQQLAGA
MEQIGLLDRQTDALKVKRANNSLAATRAQEAASTARDRAGEAKQMLEGPLRDRYRTAQEL
VEHRAQGAQQAGNRAQQLREEAAGLLQDAQGKLQRLRALEEEYERNERMLDAKAAQLGGL
EARMREVLATINQQVQIYNTCQ
Download sequence
Identical sequences U3KEZ7
ENSFALP00000013601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]