SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014094 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014094
Domain Number 1 Region: 3111-3422
Classification Level Classification E-value
Superfamily BEACH domain 2.09e-110
Family BEACH domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 3539-3786
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.29e-33
Family WD40-repeat 0.0061
Further Details:      
 
Domain Number 3 Region: 3013-3115
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-22
Family PreBEACH PH-like domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSFALP00000014094
Domain Number - Region: 1579-1695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00161
Family Pentraxin (pentaxin) 0.05
Further Details:      
 
Domain Number - Region: 700-840,1274-1367,2302-2426
Classification Level Classification E-value
Superfamily ARM repeat 0.0547
Family Armadillo repeat 0.066
Further Details:      
 
Domain Number - Region: 2310-2400,2435-2492,2521-2567,2768-2847
Classification Level Classification E-value
Superfamily ARM repeat 0.095
Family PBS lyase HEAT-like repeat 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014094   Gene: ENSFALG00000013506   Transcript: ENSFALT00000014152
Sequence length 3801
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603172.1:24783261:24847340:1 gene:ENSFALG00000013506 transcript:ENSFALT00000014152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSASNSLAREFLTDVNRLCNAVVQRTEAKEDEEEETHMAALGQYLVQGRGFILLTTLNS
IIDQELTCREELLTLLLSLLPLVWKIPVQEEKAIGFNIPFTVDICLTKENNTSSVKSTQE
KLNLDGSAHSSLQTPVKLSLRSRKSGRLRKTTHRYSVRDARRSQLSTSDSEGNSDEKTAV
ITKHRRSQILQPFLSPSVRDSYPGGRSDCRPPEVVPGSNTDASNLESSSKVVPAHEILNE
PAVGTSESNRDNSPFDLCHVLLSLLEKVCKFDITLNHSSALSASVVPTLTEFLSGFGDSC
NVSSNTENEVVSAGWTEEPVALIQRMLFRTVLHLMSLDISNTETMPDNLRRNLTDLLKAA
LKIRICLEKQSGPFASGYKKTLQQLVQDDYIFSRYRHRALLLPEVMEGVLQILICCLQSA
ASNPFYFSQAVDLVHEFIQQQGFKLFEVTVLQMEWLCMKNEGAPGEASEHLKALINSIMK
IISTVKKVKSDQLHQSVCTRKRHRRCEYSHFMNHHRDLSGLSVSAFKNQASKNPFETADG
EVDYPERCCCIAVCAHQCLHLLQRVSLSSTCAEILSGVYNVGICCCMDPKSVIVPLLHAS
KLPILKSFQQHILNILNKFILDQLGGAEVSPKIIQASCNICTVDSDQLAQLEDALQGNSS
DTSPTSSSSCRVQGILPSTGSEDMLLRWHALEAYQDIIFEEDKLRGAQIASHICHLIQKG
NVVVQWKLYNCIYHPVLQRGVELACHAQQQLGLSTADKLLCSYHSQDLPSEVLQVYLQML
PVLLKSRVIRDLFLSCNGVNQMIELNYLDTLRIHSLKVLETLILCLDDQQEDQATPELEG
LNSEQKESMSDLPTSLCSQPAISEVPQSLSKFYAGLKEAYPKKKKFVSQEIHVNTINLFL
CVAFLCISKEADGDLDSANECEDTSGYDSTASEPLGHKLPYLSLESLTLPSLEHIHRTAD
IWSMCRCIYLYSSVFQRQFHRLGGFEACQRLIILIIQKLAKNKEKEQEKRERVLSESSRS
SHGSPRTELLNKDDSVQLAKSREVTQLELDSSGSPAGAEQLVPDSVSCDSPVGMEHALVS
SVANLEGIRTSAREETEWALQGIRLLEALLTICLHSASTIQQKTEGEVFHQNTCVDDILL
EIREQLAQSKVIETDLAKPLFDSLLRVALGTFSADLDHSEEKTEKTHYPEKEPVSQPGEI
SEETEESQCCSLKLFAEEEGYEADSESNPDDSETKNEGADTKAEPGCTGVSGYFNGLAEN
INQGELMYPEICMLELNLLSAGNASLDVLAHVFQSCLNIINQKERNATVLIEQGAVKHLL
GGFLNILTQTDSSFHACQMVLVDLLVSLMSSQTCSEELTLLLRIFLEKTPCTEVLLKGVL
KIVNTNIYMNPLQYLAFPFLNGTNLSSSSSQKCTGTSNNKNAGLLKRTKLSQSKKEADGE
NLSHQLLSSWHVAPIHLPLVGQNCWPHMSDGFSVSLWFRLEYAHETESSTEKGKKVKRRS
RLIAVRENSFDSTEETKSIGMEYASLGDKLVEDGCIHVISLGSKALMIQVWADMNTGAFI
FRMCMDPNDEMKAGLLAQAESPGNVFLVGRWQHLALTYLQKPEGKKNFHGKLLLWVSGQR
QCEMNLDFALPRKTSLSSDSNKTFCMIGHCTSSQEDLLRLSGRWDLGNLLLFNGANIGPE
EAFYLYTCGPDFTSVMPCKYGKTLIDCSKYISKEILQCEQIKELFMAKKEVDIGILIESL
AVVYTTSCPGQYTIYEPVIRLKGQVKTVPSQRPFSLKEVQSNVLDSYHLKALQPVEYKTL
QGILHEIGGTGAFVFLFARVVEISSCEDTQALALQLILSLTKYNQQRIQEMDNCNGYSMI
RRVLIKPQCIVGFCMLKTLLEGCCSDEILYINESGQFQLDPDSTAVIQDVQLLEKLLLDW
KIWSKAKQGVWETLLAALEILIRANHHQQMFNIKQLLKAQVVHHFLLTCQVLQEHKEGHL
ASLPREVCRSFVKIIEEVLGSPPDLELLTLVFNFLLAVHPPTNTYVCHNPTNFYFSLHID
GKIFQEKVESLRYLRNSSSGGKSVDNSAFVITSPTGFTALPLEGSTSKASVQQKITSQVP
KRLSKSLPASPTSSPQVHQKRLGSSVDDLQILSERDYIDLQGRIGLVESSETVKRVQEEL
FLSSCESAKTVCDSELTSAETFEDIAKEVELSENALESKEADTDLKCNEAAGGGGAAEVA
LRRPDNLKGLPSLQKGQSNFAGLGLAFSVLGASSAIARWPSFADKNVVPEDWDSLAFSSA
NENTPKPSESPDDRCAEDYLVLICCGLYDLLRGVLLILPDIMLEDVMDKLIQPDYLIVLV
NHPSPLIQQGVIKLLDAYFNRARREQKEKFLKNRGFSLLANQLYLHQGTQEVIECFLEML
FGRSVGLDEEFDLEDVKNVGLFRKWCVIPVLGLIENSLYDNVLLHNCFCLLLQIINSCSK
VADLLLDNGLLYVLCNTLAALNGLETNIPLNDYKLLACDIQQLLVAVAIHACSSSGSQYF
RVIEDLIVLLGHLQNSKNARMQNMAVVLQLRVLQAAIELIKTTASQDAQEQASSAPAPSA
PHRAMFQKRKGIAGSRKFSLAQSDALLVKMRSLASEEFNMMMQRRMSQENPIQATESEFA
QRLQRLTVLAVNRLIYLASTEECLDVLGITENTSQSRLSASQLEVPEEESQQELISRINP
FLKEMFKMLVEGIKVSIGTSRMSTPKQQWNRILLLCKDTFRTQLGRLLVHSLSPVRPLQE
RKQALEMVPEVNQQEILRDCLSPTLQHGPKLVLYLYELMHNHSDGMTKEQQRAAGDLMNT
LKSCGYKCIPLSPRPKPDLIKALKEDQKKYEREEGVSKAAWEKTMANNRQNLFQRLDTKS
KDISKIAGDITQAVSLSQGMERKKVIQHIRGMYKAELSASRHWQELVQQLTHDRALWYDP
VYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLPDRQKQEGMIKTPLSYLFEDKTHSS
HSSTVKDKAASEHIRVNRRCVSVAPSRETAGELLLGKCGMYFVEDNASDTIENSSFHGET
EPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNLP
NLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYTNETLDL
NDPSVYRNLVKPIAVQSKEKEDRYVDTYKYLEEEYRKGAREDDPMPPVQPYHYGSHYSNS
GTVLHFLVRLPPFTKMFLAYQDQSFDIPDRTFHSTNTTWRLSSYESMTDVKELIPEFFYL
PDFLVNREGFDFGVRQNGDRVNHVNLPPWARNDPRLFILIHRQALESDHVSQTICHWIDL
VFGYKQKGKASVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQLFHAAHV
SRPGSRLIMEGELPAAMGLLVQFAFRETREHTKEIIYPSPLPWIKGLKWGEYVGSPSAPD
PVVCFSQPHGERFGSLQALPTKAICGLSSKFCLLMIYSKEQGVRSMHSTDIQWSAILSWG
YADNILRLKSKQSEPPVNFIQSSQLHQVTSCAWVPDSCQLFTGSKSGVITAYMNRFTSNT
PSEIEMESQVHLYGHTAEITSLFVCKPYSIMISVSKDGTCIIWDLNRLCYVQSLAGHKSP
VTAVSASETTGDIATVCDSVGGGSDLRLWTVNGDLVGHVHCRESICSVAFSNQPEGVSVN
VIAGGLENGVVRLWSTWDLKPVREITFSKSAKPIVSLTFSCDGHHLFTANSDGNVIAWCR
KDQQRLKLPMFYSFLSSYAAG
Download sequence
Identical sequences U3KGE0
ENSFALP00000014094 XP_005043864.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]