SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014961 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014961
Domain Number 1 Region: 483-663
Classification Level Classification E-value
Superfamily SPOC domain-like 3.37e-49
Family SPOC domain 0.00033
Further Details:      
 
Domain Number 2 Region: 117-272
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.37e-30
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014961   Gene: ENSFALG00000014346   Transcript: ENSFALT00000015026
Sequence length 665
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603359.1:353410:355407:1 gene:ENSFALG00000014346 transcript:ENSFALT00000015026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDRPLKVEPVYLRGGRRSRTPPPAPSPEPLGYLPPLHSAYQYKQRSLSPVTSPLLREPRP
RHAAAAAFALEAAAIGLSRERERALDYYGLYDERGRPYSYPIVAEEDLMPEDDQRATRNL
FIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSG
RVVGRNPIKIGYGKANPTTRLWVGGLGPSTSLAALAREFDRFGSIRTIDYVKGDSFAYIQ
YESLDAAQAACAQMRGFPLGGPERRLRVDFAKAEETRYPQQYQPAPLPVHYELLADGYSR
HRSLEQDLRVRDRTPPHLLYSDRDRSFVEADWASPAKNAERRNNLESYSRSMRSRSGERW
GSDGDRSVPKPWEERRRRRSLSSDRGRTTHSPYEDRSRTKASGPALDRSPDRARKENHTT
EPGAEKEQSNSLQNNRHAAEEKPHREPADAPQPKKRDSERNHRTGESESKTHEEPKSETK
KLKNLSEYAQTLQLAWNGLLVLKNSCFPTSMHILEGDLGVINGLLKDHSSGGKLTQLKIA
QRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQSAPAGAGAEGTFPVVEPGLQRRLLRNLV
SYLKQKQAAGVISLPVGGAKGRDSTGMLYAFPPCEFSQQYLQSALRTLGKLEEEHMVIVI
VKDTA
Download sequence
Identical sequences U3KIV7
ENSFALP00000014961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]