SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000014993 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000014993
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.93e-22
Family Pointed domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000014993   Gene: ENSFALG00000014378   Transcript: ENSFALT00000015058
Sequence length 80
Comment pep:novel scaffold:FicAlb_1.4:JH603235.1:4336783:4337022:1 gene:ENSFALG00000014378 transcript:ENSFALT00000015058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGSNSFWMSILSEYWSEHSICEWLQFCCDQYKLDAKCISFSHFNINGLQLCNMTQEQFVD
AAGLCGEYLYFILQNCRMYG
Download sequence
Identical sequences U3KIY9
ENSFALP00000014993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]