SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000002964 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPSIP00000002964
Domain Number - Region: 41-111
Classification Level Classification E-value
Superfamily PH domain-like 0.0205
Family Pleckstrin-homology domain (PH domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000002964   Gene: ENSPSIG00000002871   Transcript: ENSPSIT00000002976
Sequence length 126
Comment pep:novel scaffold:PelSin_1.0:JH207676.1:1696936:1798746:-1 gene:ENSPSIG00000002871 transcript:ENSPSIT00000002976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEEKGVSPAHRTSTPSHKSASSSLSSQRDIRQSAHVLERNSSFGSTDASVSKQLFETE
SVSLSKEPDSWEIIEGLKIGQTNVQKPDKHEGFMLKKRKWPLKGWHKVMLVNCVRLNLCF
VKPMHC
Download sequence
Identical sequences K7F4K4
ENSPSIP00000002964 ENSPSIP00000002964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]