SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003101 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPSIP00000003101
Domain Number - Region: 129-192
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00389
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number - Region: 29-124
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0063
Family Ras-binding domain, RBD 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003101   Gene: ENSPSIG00000002987   Transcript: ENSPSIT00000003114
Sequence length 240
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211509.1:21:8066:-1 gene:ENSPSIG00000002987 transcript:ENSPSIT00000003114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVRQDPVLGGSETFNSFLRKAQQETQQVPTEEVPLEVLLSNGQKVVVTILTSDQTEDV
LEAVASKLDLPEDLVGYFSLFLAREAKDGAFSFVRKLQEFELPYVSVTSLRNPEYKIILR
KSYWDSAYDDDVMEQRVGLNLLYAQTVSDIERGWILVTKEQHRQLKSLQEKVSKKEFIRL
AQTLKYYGYLKFEPCITDFPEKGCQVVVSAGNNELNFQVPTSSGPLGSSPGKAEVKLELA
Download sequence
Identical sequences K7F4Z1
ENSPSIP00000003101 ENSPSIP00000003101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]