SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003544 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003544
Domain Number 1 Region: 109-215
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-29
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-28
Family Third domain of FERM 0.0038
Further Details:      
 
Domain Number 3 Region: 14-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.59e-18
Family First domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003544   Gene: ENSPSIG00000003374   Transcript: ENSPSIT00000003562
Sequence length 601
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208705.1:757281:828399:-1 gene:ENSPSIG00000003374 transcript:ENSPSIT00000003562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLLQSRMQQEYRNVCVLLPNREQLSVTIGVKATGQELFQQVCDLVKIKDPHFFGLSI
IKNNEYVFMDLEQKLSKYFSKEWKKETNKGTEKFTPPFVAFFRVQYYVENGRVISDKAAR
HLYYCHLKEQVLRSRCSHKEEIYFLLAAYSLQADLGSYAENVHVGKYFEPQAYFPQWIIA
KRGSDYILKHAPEIHQEQKGLSTKDAILQFIKESCLLEDVPVHYFRLQKDKKEDRPTVVL
GLTLKGIHIYQEVNHVRQLLYDFPWSHIGKLAFLGKKFEIQPDGLPSARKLVYYTGCPFR
SRHLLQLLSNSHRLFLNVQPVLKQIQKLEEVEEKKRYRESYISDTLEMDLDPSDKHSHGS
GSSGGSQRVNRLSRQSTGSHGSSHTSGIEADSRHRMSVEMSVDEPFSIERVHRKEKSCSS
TVSCGSSGIDSGGKGRVEEDSQDDEVELAVDDPVERNQLEEAAEGECASPLALDALCCQA
LKKKPLPVVQVTLIQMRGQSVESLHQVRQPKGRSCADQHSQSLDDIRLYKHQHPPISSTL
SSDTSHSYTFGCALDDKLASYGCVYSTADCKTKSALYGKRSMNCLSLDLLGEDQLPEEFV
V
Download sequence
Identical sequences K7F684
XP_006122989.1.96668 ENSPSIP00000003544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]