SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005811 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005811
Domain Number 1 Region: 566-654
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-20
Family Third domain of FERM 0.0061
Further Details:      
 
Domain Number 2 Region: 380-472
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 271-322
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000641
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number 4 Region: 524-565
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000353
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000005811
Domain Number - Region: 26-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00562
Family Ubiquitin-related 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005811   Gene: ENSPSIG00000005395   Transcript: ENSPSIT00000005845
Sequence length 677
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212622.1:456015:489767:-1 gene:ENSPSIG00000005395 transcript:ENSPSIT00000005845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSNEYGSSSWELIVTVDHQYEEEQKEFTLRVSGDLHVGGVMLKLVEQIKISRDWSNYA
LWWEQKKCWLLKTHWTLDKCGVQADAKLLFTTQHKMLRLRLPNMKTVRLKVSFSSVVFKA
VSEICKALNIRRSEELSLLKQSEDTLKKKKKKDKNNKEPVIEDILNLYNSPVISGSPASP
GLYSKTMTPMYDPVNGTPVSSTVTWLRDSPLAAPNCSILAFSHPNYSPETLAEMYQPRTL
ADKAKRNAGWLDSSRSLMEQGVQEDDQLLLRFKYYSFFDLNPKYDAVRINQLYEQARWAI
LLEEIDCTEEEMLIFAALQYHLSKLSLSSEAQDFTSESEVDEVEAALSNLEVTLEGGKTD
SILEDITDIPKLADNLRLFRPKKLTLKAFKQYWFVFKDTSISYFKNKESGHGEPIEKLNL
KGCEVVPDVNVAGRKFGIKLLIPVADGMNEVYLRCDNENQYAFWMAACNLAAKGKTMADS
SYQPEVQNILSFLRMKNRPMSPQVVSDPESMGMKPECFVSPRYAKKYKSKQLAARILEAH
QNVAQMSLVEAKLRFIQAWQSLPEFGLTYYIVRFKGSKKDDLLGVSYNRLIRIDAATGDP
ITTWRFSSMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQ
NETLDEDLFHKLTGGQE
Download sequence
Identical sequences K7FCQ1
ENSPSIP00000005811 XP_006136072.1.96668 ENSPSIP00000005811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]