SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008026 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008026
Domain Number 1 Region: 186-329
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-39
Family Third domain of FERM 0.00000434
Further Details:      
 
Domain Number 2 Region: 82-187
Classification Level Classification E-value
Superfamily Second domain of FERM 4.32e-36
Family Second domain of FERM 0.00000129
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-26
Family First domain of FERM 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008026   Gene: ENSPSIG00000007374   Transcript: ENSPSIT00000008068
Sequence length 779
Comment pep:known_by_projection scaffold:PelSin_1.0:JH205562.1:1083671:1176196:1 gene:ENSPSIG00000007374 transcript:ENSPSIT00000008068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCKVSLLDDTIYECTLDKHAKGQDLLRKVCEHLNLLEEDYFGLAIWDSPTSKIWLDSTK
EIKKQVHGGPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRHDIVTGRLPCSFATLALLS
SYTVQSELGDYDPELHNTDYVSEFKLAPNQTKELEEKVMELHKTYRSMTPAQADLEFLEN
AKKLSMYGVDLHQAKDLEGVDITLGVCSSGLLIYKDKLRINRFPWPKVLKISYKRSSFFI
KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTETLPKSRFLALGSKFRY
SGRTQAQTRQASALIDRPAPQFERTASKRASRSLDGAKHTSQVEVRPIVEEKQDDVVMVE
IPESKPVEQFREKPAKHTFENIEMKSIAEEEEEEKMEVFKVTVPESKLMEPFQKQPVIRV
HENIEITPINEEEEEEKVVTMKDLELEPKFLEPVQKEPVAVITPDRSPRPTSAPAIAQRH
VAEPTPPASSDTKEIVVVSKVEKEALDTEGKREEMPYELVKMEPPEVAKVGKTHIEVTLP
TTNGDQPQQPAEKEEEPIRMRKKRSKKLDGENIYIRHSNLMLEELDKTQDEIKKHHANIS
ELKKNFMESVPEPRPNEWDKRLSTHSPFRTFNVNGQVSTGVEGPPLVKTQTVTISDVSNA
VKSEIPTKEVPIVHTETKTITYEAAQIDDGNGDLDPGVLLTAQTITSETTSSTTTTQITK
TVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEITDE
Download sequence
Identical sequences K7FJ16
ENSPSIP00000008026 ENSPSIP00000008026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]