SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008851 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008851
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily PDZ domain-like 8.04e-18
Family PDZ domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008851   Gene: ENSPSIG00000008084   Transcript: ENSPSIT00000008897
Sequence length 116
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212057.1:311832:340925:1 gene:ENSPSIG00000008084 transcript:ENSPSIT00000008897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILISKIFKGLAADQTEALYVGDAILSVNGADLSEATHDEAVQALKKTGKEVVLEVKYM
KEISPYFKNSSSGATVSWDPAPAASLQKQASPILSLRDLKEGKNVPLKMCYLARKC
Download sequence
Identical sequences K7FLE1
ENSPSIP00000008851 ENSPSIP00000008851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]