SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010013 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010013
Domain Number 1 Region: 228-373
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-38
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-36
Family Second domain of FERM 0.0000489
Further Details:      
 
Domain Number 3 Region: 41-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-23
Family First domain of FERM 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010013   Gene: ENSPSIG00000008929   Transcript: ENSPSIT00000010064
Sequence length 755
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224644.1:9971586:10072684:-1 gene:ENSPSIG00000008929 transcript:ENSPSIT00000010064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFFRRTLGRRSMRKHVEKERLREAQRAVTHIPAAGDAKSIITCRVSLLDGTDVSVDLP
KKAKGQHLFEQIMYHLDLIENDYFGLRFMDSAQVAHWLDNTKSIKKQVKIGPPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTTVQLAAYTLQAELGDYDPAEHI
PDLVSEFRFVPTQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHIVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDEQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKGSSRSSFIRLGSRFRYSGKTEYQTTKTNK
ARRSASFERRPSKRYSRRTLQMKANVAKLEETSIPNNVLNQNNGSQSWNAKPTLPVMTVS
SGPVLVEIENLPRSPGASLQDKKCMPLIVDLLDSKELLESCIDEATGLPVPSLTTGVPEE
MXXXXPADTQERAAEKTDPAAFEDTLLKLKHLEMEASPMSVPCSNINININKQDDVVKLT
DKCLNNAFPADIKSNILKAQAEAAHKVTREDSVSDKNSNNQDASARSSLISGKAQSSLLP
TNPVFLESREALKEIPASNAFLPHALEEDNATSGPEESPIPVILASAEEIAVLKSSPDDL
DVSLISLAENLIDFTEAVPRVSSQPTVTPRWIVPSGMISNGPLGNDVLALKAVKGSTEAL
SLSAGSPSQQTAEILASPITEDPAIRPKCLLTTEL
Download sequence
Identical sequences K7FPQ3
ENSPSIP00000010013 ENSPSIP00000010013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]