SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010728 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010728
Domain Number 1 Region: 17-307
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.67e-82
Family Motor proteins 0.0000115
Further Details:      
 
Domain Number 2 Region: 759-862
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.72e-20
Family First domain of FERM 0.032
Further Details:      
 
Domain Number 3 Region: 854-948
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000359
Family Second domain of FERM 0.0093
Further Details:      
 
Domain Number 4 Region: 1089-1145
Classification Level Classification E-value
Superfamily SH3-domain 0.000000019
Family SH3-domain 0.0042
Further Details:      
 
Domain Number 5 Region: 301-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000231
Family Motor proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010728   Gene: ENSPSIG00000009721   Transcript: ENSPSIT00000010782
Sequence length 1325
Comment pep:novel scaffold:PelSin_1.0:JH206962.1:24059:81850:-1 gene:ENSPSIG00000009721 transcript:ENSPSIT00000010782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKEHTDYLIIILMGHMLDCFFLLQGTDTTMLYKLNSQHKLNSNYIPPKNNHETQFGINH
FAGVVYYETKGFLEKNRDTLHGDIIQLVHSSKNKFIKQIFQADVAMGAETRKRSPTLSSQ
FKRSLELLMRTLSGCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMMETIRIRRAGYP
IRYSFVEFVDRYRVLMPGVKPAYKQGDLRGTCQRIAEAVLGKDDDWQIGKTKIFLKDHHD
MLLEIERDKAITDKVILIQKVVRGFKDRSNFLKVRHSALIIQRYWRGHNCRKNYDAMRIG
FLRLQALYRSRKLHTQYHMARRRIIEFQARCRGFLVRRAFRHRLWAVFTVQAYARGMIAR
RLYKRLKGEYRRRLEAEKLRLAEEERLRKEMSAKKAKEEAEKKHQVRLAQLAREDAEREV
KEKEETRRKKEFLDKMEKARNEPVNDSDMVDKMFGFLGTTSSLPGQEGQAPNGFEDLERA
QKEVEEEDLDASLPLPEEEEEDLSEYKFAKFAATYFQGTTTHTYVRRPLKQPLLYHEDEG
DQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKKELQALQGE
GESTHIDGHKKNSVRHKLVSLTLKKKSKLTEEVTKRLHDGESTLQGNSMLEDRPTSNLEK
LHFIIGNGILRPALRDEIYCQICKQLTQNPSKSSHARGWILMSLCVGCFAPSEKFVKYLR
NFINGGPPGYAPYCEERLRRTFANGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLL
TDSATTAKELCNSLADKISLKDRFGFSLYIALFDKVSSLGSGNDHVMDAVSQCEQYAKEQ
GAQERNAPWRLFFRKEIFTPWHNPNEDNVATNLIYQQIVRGVKFGEYRCDKEEDLAELSS
QQYYVDYGAAMVLERLLNLIPSYIPDREITASKTVEKWAQLIIAAHKKGIYTQKRADPKK
VKEEVVDFARFKWPLLFSRFYEAFKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSF
PEITAVSSSRGGKLQGQSFTLATIKGDEYTFTSNNAEDIRDLVVTFLEGLRKRSKYVVTL
QDNPNPVGEDSGFLSFLKGDLIVLDQDTGEHVMNSGWANGVNERTKQRGDFPTDCVYVLP
TVTMPPLEIVALVTMTPDQRQDVIRTSQLAISDSEERVKPYTLEEFSYDYFRPPPKHTLS
RVMITKNRGKDKLWCYTREPIKQPLLKKILGSEELSQEACMAFIAVLKYMGDYPSKRTRS
VNELTDQIFXXXXTLRSLSSSLTTTSSIAKRRVGNCFGCAQAFSLLATSSCPMSRGFSSP
GSITP
Download sequence
Identical sequences K7FRR8
ENSPSIP00000010728 ENSPSIP00000010728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]