SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011975 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011975
Domain Number 1 Region: 395-538
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-41
Family Third domain of FERM 0.0000103
Further Details:      
 
Domain Number 2 Region: 291-396
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-35
Family Second domain of FERM 0.00000359
Further Details:      
 
Domain Number 3 Region: 211-290
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-26
Family First domain of FERM 0.0000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011975   Gene: ENSPSIG00000010546   Transcript: ENSPSIT00000012033
Sequence length 997
Comment pep:known_by_projection scaffold:PelSin_1.0:JH207526.1:1462333:1725440:-1 gene:ENSPSIG00000010546 transcript:ENSPSIT00000012033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGPETEVKKESEQLEADAAKNKQDEATENQENQKSEKTVSEEAQGSPSPALGTQSS
PSSQKKEKEPSEGKGISRFIPPWLKKQKSYSLVEPKDEAKKKPVEEGETVEERECQLPGE
VVQPKGSVEEATIESEREAKAEDKEEKHSVSSAETQPAKEDNKEIEVEKVADEQEEKQKA
EENRETKEVQTAEINMEKVPQKAPKKIKTVQCKVMLLDGTEFSCDIEKRAKGQVLFDKVC
EQLNLLEKDYFGLLFQDNSDQKNWLDSSKEIKRQIRSLPWLFTFNVKFYPPDPSQLTEDI
TRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEENNNDYISEFQFAPNQT
KEMEEKVVELHKTHRGLTPAQADSHFLENAKRLSMYGVDLHHAKDSEGVDIMLGVCANGL
LIYKDRLRINRFAWPKILKISYKRSNFYIKVRPTEQEQFESTIGFKLPNHRAAKRLWKVC
VEHHTFYRLISPEQPPKAKFLTLGSKFRYSGRTQAQTRQASNLIDRPAPYFERTSSKRVS
RSLDGAPVGIIDQSLLRDFSAATVGPAGDMVFDGEAVGQTKLRDGEGRDEDGSPTKISQL
ELTQDEKNNSLRVDGGNIYVRHSNLMLEDLDKTQDDLLKHQASISELKRNFMESTPEPRP
NEWEKRRITPLSLQTQGSSHETLNVVEEKKQAEVGIEETVVIEELNRGKMQAVTDAGETR
KVEHLSKKDSSSLSSDSSSSSESEDEVVGEYQPHYRVAKDTIREEQEENEDAKGKEERAT
KTIQSEETVQEGSKIKVTVEHNQITAKALAQENAVAIKVGEKNVMEEEKQDLRAEDEQLR
INGDVSHVDIDVVPEIICCSEPPVVKTEMVTISDATQRTEISTKEVPIVQTETKTITYES
PQFDGSAGGDAGVLLSAQTITSESVSTTTTTHITKTVKGGVSETRIEKRIVITGDADIDH
DQALAQAIKEAKEQHPDMSVTRVVVHKETELAEEGEE
Download sequence
Identical sequences K7FVB5
XP_006118671.1.96668 ENSPSIP00000011975 ENSPSIP00000011975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]