SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012393 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012393
Domain Number 1 Region: 650-709,747-846
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-30
Family Pleckstrin-homology domain (PH domain) 0.0053
Further Details:      
 
Domain Number 2 Region: 854-971
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 1263-1396
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-18
Family Second domain of FERM 0.0049
Further Details:      
 
Domain Number 4 Region: 1165-1244
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000496
Family First domain of FERM 0.074
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000012393
Domain Number - Region: 72-166,752-772
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000146
Family BAR domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012393   Gene: ENSPSIG00000011173   Transcript: ENSPSIT00000012454
Sequence length 1539
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224651.1:6963519:7094109:-1 gene:ENSPSIG00000011173 transcript:ENSPSIT00000012454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLKAAVCDATSAAPLRIQAEARRNPSAKTGPSCPAASRSLASLSMADFSDSEGSVNWK
ERCVTLESQLMKFRLQASKIRELLAEKMQQLERQVIDADRQAERAFQQVQIMEEKLKAAN
VQTSELETRLYKRCQDLETLLQEKDDIIQNLEQQLEEQKQIRIQEAKIIEEKAAKIKEWV
TVKLHELEVENQNLRSINQNQNEEMRTMQSKLQESKGKKCVPSTHKPGEGQRLSSLTFGC
FMNRARSSQQAIKFDEISKSSSKESELSDEKNFQQPSLAALPHESNKGQRSLHQSTCGSE
QNKNSRTNYPSKDTDSSIPKNTCMLGSDWSSDEDEGHDKRPKSTCASTLSSQTSEESARY
SRIGSEMYLTASDDSSSLCEEDSFAVQKSEHNQLYSRQHGCQWKSQNNPFGKSNSECLGR
KEQDRSSDELNKKFQSQRLDCSSSSSKANNPSSILISALALKYPVLTPTADSRCVTQSNS
SSNLPPPKLRTPNVFSISVALAKKHLSQPQLSSDRMFDRNRNAISMIRPLRPQETDIDLV
DAENTDIVEKMEIDFDGTFTYDSFEAQGEEDQESSDITRKAISNKPPTPPLHRFPSWESR
IYAVAKSGLRMSEAFNMDSFNKSTAAIASCTISGLYTSLIYKNMTTPVYTILKGKATQIS
NSPFLDDSSGSEEEDSSQCSSQTSESDSRSRSGPGSPRAMKRGVSLSSMASESDYAIPPD
AYSTDTEYSEPEQKLPKTCSSSSDNGKNEPLEKSGYLLKMSGKVKAWKRRWFVLKGGELL
YYKSPSDVIRKPHGQIELSVSSHIVRGDGKQTVQLITEKRTYYLTADSPNILEEWIKVLQ
NVLKIQAASPLFIQPDVKPAMKGLLTKVKHGYSKRVWCTLVGKTLYYFRSQEDKFPLGQI
MLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKEQGPTYLLIGSKHEKDTWLYH
LTVAAGSTNVNVGSEFEQLVCKLLNVEGEHTSQIWRHPTLCHSKEGIASPLTTLPSEALQ
TEAIKLFKTCQLFINAAVDSPAIDYHVSLAQSALQICLTHPELQNEICCQLIKQTRRRHP
QNQAGPIQGLQLLALCVGLFLPQQPFLWLLKLHLKKNADSRTEFGKYAIYCQRCVERTQQ
NGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQD
TGMRKPVQSGFALFTDDPSGKDIEHCLHGNIKICDIISKWEQASKEQHPGKCEGTRTVRL
TYKNRLYFAIQARGETDREKLLLMYQTNDQIVNGLFPVNKELALEMAALLAQVEIGDFER
PFSTPAGQVTSPSKSNQTLKQVVEKFYPKRYRHGCSEEQLRQLRQRLSTRWMALRGQSAA
DCVRIYLTVARKWSFFGAKMFAAKPLTTSTFENSFIWLVVHEDGVSILEYSFLRLIVTYV
HKSLMTFGGYQDDFMLIVNNAQSKDKSNEKLLFAMAKPKILEITLLIASYVNHFHQQKGA
VNHLSTSTLFSPQTGQKTKEMGSQLLLSNSRPTKGPTLL
Download sequence
Identical sequences K7FWI3
ENSPSIP00000012393 ENSPSIP00000012393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]