SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015966 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015966
Domain Number 1 Region: 605-693
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 412-505
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-17
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 3 Region: 302-353
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000628
Family Second domain of FERM 0.013
Further Details:      
 
Domain Number 4 Region: 551-604
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000746
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000015966
Domain Number - Region: 44-121
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00756
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015966   Gene: ENSPSIG00000014143   Transcript: ENSPSIT00000016041
Sequence length 716
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206845.1:2387453:2504446:-1 gene:ENSPSIG00000014143 transcript:ENSPSIT00000016041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLILPPPYWRLPPSTRRFLAARTTGEEGTMALDGIRMPDGCYADGTWELNVHVTDLNRDV
TLRVTGEVHIGGVMLKLVEKLDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADARLQ
FTPQHKLLRLQLPNMKYVKVKVNFSDRVFKAVSDICKTFNIRHPEELSLLRKPRDPTKKK
KKKIDDQSEDEALELEGPLITPGSGSIYSSPGLYSKTMTPTYDSHDGSPLSPTSAWFGDS
ALSEGNPGVLAVSQPITSPEILAKMYKPQALLDKAKINQGWLDSSRSLMEQDVKENEALL
LRFKYYNFFDLNPKYDAIRINQLYEQSKWAIVLEEIECTEEEMMMFAALQYHVNKLSIMS
SENHLNNSDKEVDEVDAALSDLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKG
YKQYWCTFKDTSISCYKSKDESNGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVADGM
NEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQ
VTADINPECLVSPRYLKKYKNKQPGYIRDLITARILEAHQNVAQMSLIEAKMRFIQAWQS
LPEFGITHFIARFQGGKKEELIGIAYNRLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMV
TVEFADDVRVSFICTEVDCKVVHEFIGGYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences K7G6Q5
ENSPSIP00000015966 ENSPSIP00000015966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]