SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016270 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016270
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 1.25e-44
Family Third domain of FERM 0.000000132
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 8.5e-39
Family Second domain of FERM 0.000000755
Further Details:      
 
Domain Number 3 Region: 493-580
Classification Level Classification E-value
Superfamily Moesin tail domain 2.62e-32
Family Moesin tail domain 0.00000583
Further Details:      
 
Domain Number 4 Region: 5-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-25
Family First domain of FERM 0.00000865
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000016270
Domain Number - Region: 426-468
Classification Level Classification E-value
Superfamily Tropomyosin 0.0157
Family Tropomyosin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016270   Gene: ENSPSIG00000014443   Transcript: ENSPSIT00000016346
Sequence length 580
Comment pep:known_by_projection scaffold:PelSin_1.0:JH212625.1:593351:637111:-1 gene:ENSPSIG00000014443 transcript:ENSPSIT00000016346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIFQISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEMHKPGYLTGDKLLPQRVLEQHKLSKDQWEERIQVWHEEHR
GMLREDAILEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEHNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKHMERALLENEKKKRELAEKEKEKIEREKEELMERLKQIEEQTKK
AQLELEEQTRRALELEQERKRAQEEAEKLAKERREAEEAKEALLKASHDQQKTQEQLSAE
MSELTSRISQLEVARQKKESEAMEWQQKAQTVQEDLEKTKEELKMAMSTPHVTEPMQSEN
EQDDEQDENAAEASAELRADATIKDRSEEDRTTEAEKNERVQKHLKALTSELANARDETK
KTANDMIHAENMRQGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences K7G7K9
ENSPSIP00000016270 ENSPSIP00000016270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]