SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017046 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017046
Domain Number 1 Region: 553-616,657-754
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-31
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 761-887
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1175-1306
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-18
Family Second domain of FERM 0.007
Further Details:      
 
Domain Number 4 Region: 1075-1152
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000377
Family Ubiquitin-related 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000017046
Domain Number - Region: 35-68,662-682
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0126
Family BAR domain 0.075
Further Details:      
 
Domain Number - Region: 1307-1393
Classification Level Classification E-value
Superfamily PH domain-like 0.035
Family Third domain of FERM 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017046   Gene: ENSPSIG00000014956   Transcript: ENSPSIT00000017124
Sequence length 1456
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206102.1:126920:212350:1 gene:ENSPSIG00000014956 transcript:ENSPSIT00000017124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELAMENGSCMDWQKRCLALETQLFKFRLQASKIRELLAEKMQELEQRVIEAEQRAENA
EKQVRVMEEKVKLDNMKTSESESTLYRKYQELLGTVQGKDDLISRLEMQLEQQKQLRAEE
AKIIQDKAAKIKEWVTFKLRELELDNYHLKNCNQRLTEQIEALQDALQDLTNIPPIESLW
SNSPLVPRTLLSSLLEKPAQNSFLLGMGVKQECQGRAKHVPPTPTTILVDEASLAKEASK
SLSSQNMLRVIPDSSNWKPTVEKDAFCTVISDTSSGCPDPTLQDPTVESTSVLDALAFQS
SLGRNQNSLSTLEQRASELGNSSDELSAKFRSHRLDSSSSGEISIPYGCLPTAEPRLGLP
SSITSTQPSFPGRECGLSNSMTLPKIRTPSSPRDSIQLAKRHYSQPQPGAHRFHHITSIE
IGTFQPITASTLCPAPVEETDIDGDDLLEKMETEGCPVGEETGMGVETDQHPGSGKNECG
NSEAGPLDRGGKPPTPPLHRFPSWESRIYAVAKSGMRLSEVALGTNSPSWILNFPSYSNS
GPFTGLIYRNVTVPVYSTLKGKATQISNIPFLDESSGSDDDCSSHASIRTSNGGSEIRKS
STPGSPRAMKRGVSMSSLSSESDYAIPPDAYSLDGDYSEPEHKLQRTSSYSTDGGVCSEP
MEKSGYLLKMGSQVKTWKRRWFVLRNGQIMYYKSPSDVIRKPQGQAELNSSCQIIRGEGS
QTFQLITEKRTYFLTADSPNILEEWIRVLQSILKVQVTSSAALPQKDAKPTVKGWLTKVK
HGHSKLVWCALIGKAFFYYRNNEDKCPLGHLYIRKSKVEEVDRSCDSDEDYEATAGGLLS
SHYTLVIHPQDQSPTYLLIGTKHEKDTWLYHLTVAAGSSNAKVGTAYEQLIGKLLDAEGD
PQSPLWKHPMLCYSKDGLHTSLTTLPSEALQTEALKLFKSCQLFINVPVEAPSIDYHVSL
AQTALQVCLTHAELQNEIYCQLVKQTSCRQPRNHSVIQCWQLLALCAPLFLPQHHFLWYI
KQHLQRHADPRSEIGKYAIYCQRSVERTLHTGEREAKPSRMEIVSILLRNPFHHSLPFSI
PVHFMNGTYQVVGFDGSSTVDEFLQRLNQETGMRKLSHTGFSLFTDDPSGKDLEHCLQGT
VKICDVISKWEQAFKELHPGKYEGSTRIVKLTYKSRLYFRNQAKGETDRERLLLAFQISC
EIANGRFPVNKELALEMVALMAQVEYGDSDRPVSSSPGGTPQSKMQHIVQQVLDKFYPKR
YKQNITPEHLRRLADKLATKWMVLQGCSPLECIRIYLAVARKWPLFGAKVFAAKPALPSL
LEDCPVWIAVNEDGISILDYNTMHLKLSYPYSSVLTFGGCRDDFMIVVSQGKDRSSGKNS
TEKLLFTMAAPKIVEVTLLIASYINYCALTPLLSPAPPSLSVISPLSTTPTKKLWETQSQ
CFFPSVPRTTKGPTLL
Download sequence
Identical sequences K7G9T5
ENSPSIP00000017046 XP_014424126.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]