SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018202 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018202
Domain Number 1 Region: 199-350
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-24
Family Third domain of FERM 0.0054
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-23
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.99e-22
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018202   Gene: ENSPSIG00000016124   Transcript: ENSPSIT00000018287
Sequence length 1014
Comment pep:known_by_projection scaffold:PelSin_1.0:JH207158.1:1455141:1708843:-1 gene:ENSPSIG00000016124 transcript:ENSPSIT00000018287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIEVDS
EVVFELAAYILQEAKGDFVSNEIVKTDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLN
GQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKDW
QWRCLTSLYYKKQLKFPSVQVHQTELASVTRRTFGHSGIAVHTWYACPALIKSIWAMAIS
QHQFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSG
SQESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPREYPLDPGE
EPPMVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLK
KQRKTSYLNALKKLQEIENAINEYRIKSGKKPTQRASLIIDEGNIASEDSSLSDALVLED
EDSQVTSTISPLQSPHKGLPPRPPLHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSE
SSLDEPYEKVKKRSSHSHSSSHKRFPSTGSCAEAGGSNSLQNSPIRSLPHWNSQSTMPST
PDLRVRSPHYVHSTRSVDISPTRLHSLAQHFRHRSSSLESQGKLLGSENETGSPDFYTPR
TRSSNGSDPMDDCSSCTSHSSSEHYYPAQMNPNYSTLAEDSPSKARERQRQRHKSAGNLV
SSNSGSMPNLAARNGTGHHGVYLHSQSQPSSQYRIKEYPLYIEGSSTPVVVRSLENDQEG
HYSVKAQFKTSNSYTAGGMFKENWHGDEVDSVRLTPSRSQIIRTPSLGREGHEKGSGRTA
VSDELRLWYQRSTASHKEHSRLSHTSSTSSDSSSQYSTSSQSTFVAHSRVTRMPQMCKAT
SAALPHSQRSSTPSSELAATPPSSPHHIVAWQTGEATDNSPTMDESPTHQSTDE
Download sequence
Identical sequences K7GD41
ENSPSIP00000018202 ENSPSIP00000018202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]