SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000000251 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000000251
Domain Number 1 Region: 351-707
Classification Level Classification E-value
Superfamily L domain-like 1.63e-50
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 772-918
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.09e-43
Family Toll/Interleukin receptor TIR domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 19-351
Classification Level Classification E-value
Superfamily L domain-like 3.17e-40
Family Ngr ectodomain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000000251   Gene: ENSPSIG00000000250   Transcript: ENSPSIT00000000251
Sequence length 925
Comment pep:novel scaffold:PelSin_1.0:JH224649.1:4908038:4910812:1 gene:ENSPSIG00000000250 transcript:ENSPSIT00000000251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEVVPYCLQNCTIHGKRSKRMKVLCYRQNLSEVPSYLPWNVSILDLSENQIASLRQNNFR
KLSLLQVLNVSQNQIHLIEDGTFAQTSSIEILNLTSNQLRALSSFMFDGLGSLTVLLLRE
NNIDRIEPSAFAHLMKLKVIDLTSNKLHSLNALDVVFKVKSLEELHIRENEIIHFTTKDI
VNVPLWLRELDVSHNPISFMNVATDALYRLLSLDLSFSGTHNHTTWIIQDPCFLKGLKRL
YLGGTVMTPLDILDVVQKLNCSLLEEIHLNELNLTDSDNLIEKVCLWHQNVKTLNLQGNK
FKSIKGIVFENCSHLWNLDLTHNRLKVVPYISFHSLNSLQSLSLAKNEFSDVPNATSNII
SLKSLDLSFNQIKKIVPKDFANLRSLQHLNLTGNRITQISSDLFPDLHNLLELNLGMNFL
LEISQPFSDSLGKLEKMELNSNKMSALKKGTFRNLTSLQFLSLIDNQISTIEPGAFEGLS
HLQTLFLSTNKITKETFQKGIFQGLSSLVDLQLFENYISYETSEKLDNPPFILLRSVKYL
SLNSQRKSGLQHFPSNFLQGLESIVKIQAGNLVISDLDPATFSYAPTLKELDLSSNPLNP
ISPALFRPIPKLTELHLHKIGLQSLDFVLHINFSKLVMLRVSENQLNVIEPKHIRALPYL
TFLDLRQNPFTCSCDNQMFINWSLHDLETQVLYFYQYTCAFPLASKGRKLWAFHNSSCTV
DHEFILFVANTAAVILLMVVCICYRWKKQGIYTYHLLLAYIHDKRYKRTGRHKKYDYDAF
VSYNTQDKEWVMNELLPTLEDKYHWRLCLHHRDFEPGKCILKNIVDNIYASRKTICVITH
HYLESEWCSKEIQLASFRLFDEHKDVLVLIFLEHIPNDNLSPYHKMRKLVKKKTYLMWPQ
EEEEIPLFWHKLNMALKTSEGKEDE
Download sequence
Identical sequences K7EWU1
ENSPSIP00000000251 ENSPSIP00000000251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]