SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000000575 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000000575
Domain Number 1 Region: 375-554
Classification Level Classification E-value
Superfamily SPOC domain-like 1.14e-49
Family SPOC domain 0.00031
Further Details:      
 
Domain Number 2 Region: 9-160
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.6e-30
Family Canonical RBD 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000000575   Gene: ENSPSIG00000000576   Transcript: ENSPSIT00000000575
Sequence length 556
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208545.1:467320:468990:1 gene:ENSPSIG00000000576 transcript:ENSPSIT00000000575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHNVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVVGRNPIKIGYGKANPTTRLWVGGLGPSTSLAALAREFDRFGSIRTI
DYVKGDSFAYIQYESLDAAQAACAQMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPAPLP
VHYELLPDGYSRHRSLEQDLRVRDRTPPHLLYSDRDRSFAEADWASPAKNAERRNNLESY
GRSVRSRSGERWGSDSDRSVPKPWEERRKRRSLSSDRGRITHSPYEDRGRTKASGPALDR
SPDRVRKENNTTESGTERDQSNSLQNNRHVSEEKPHRETSDLPQPKKRDSERNHRTGESE
SKTHEEPKSETKKVKNLSEYAQTLQLAWNGLLVLKNSCFPTSMHILEGDLGVISGLLKDH
SSGGKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATQGGVGAEGTFPVEP
GLQRRLLRNLVSYLKQKQAAGVISLPVGGAKSRDSTGMLYAFPPCEFSQQYLQSALRTLG
KLEEEHMVIVIVKDTA
Download sequence
Identical sequences K7EXR5
ENSPSIP00000000575 ENSPSIP00000000575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]