SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000002409 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000002409
Domain Number 1 Region: 136-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-49
Family Nuclear receptor ligand-binding domain 0.000000123
Further Details:      
 
Domain Number 2 Region: 84-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-26
Family Nuclear receptor 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000002409   Gene: ENSPSIG00000002372   Transcript: ENSPSIT00000002417
Sequence length 343
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206382.1:205151:242690:1 gene:ENSPSIG00000002372 transcript:ENSPSIT00000002417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSSSCPTPGGGHLNGYPVPHYAFFFPHMIGGLSPPGALGGMQHQLPVSGYSTPSPAT
IETQSTSSEEIVPSPPSPPPLPRLCKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEAPKQECSESYIL
TPEVEDLIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKIV
EFAKRLPGFTSLSIADQITLLKAACLDILLLRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGGTGQPP
Download sequence
Identical sequences K7F2Z9
XP_006114341.1.96668 XP_006114342.1.96668 XP_014424582.1.96668 ENSPSIP00000002409 ENSPSIP00000002409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]