SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000003013 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000003013
Domain Number 1 Region: 22-247
Classification Level Classification E-value
Superfamily L domain-like 5.39e-41
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 2 Region: 268-362
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 398-471
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000128
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000003013   Gene: ENSPSIG00000002910   Transcript: ENSPSIT00000003025
Sequence length 677
Comment pep:known_by_projection scaffold:PelSin_1.0:JH210532.1:797400:803999:-1 gene:ENSPSIG00000002910 transcript:ENSPSIT00000003025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLLLVLLLMAGTLVSWAASCPFHCVCQNLSESLSTLCANKGLLFIPANIDRRTVELRL
ADNYIRVLEPHDFLNMSGLVDLTLSRNTIDSIRPFAFGDLESLRSLHLDGNRLMEIGEEA
LRGMLNLQHLILNNNQLDDSLLTLEDLDLSYNNLRRVPWEGIRGMVYLHTLNLDHNLIDS
IMEGTFSELYKLSRLDMTSNRLYTLPPDPLFARSQMGVISPTPYTATIVLSFGGNPLHCN
CELLWLGRLAGEDGRYFWSVPEEEFTCEPPLITRHTHKLWVLEGQRATLKCRAIGDPEPV
IHWVSPDDKIISNSSRTISFRNGTLDVLVTTVRDDGPYTCIAINAAGESTALVDLKIIPL
PHRGNGSSSTVLRHDPGSSDIATKTAANTTDLGVGERSVEVSDVTADSALVHWAMDRSTH
TAWMYQIQYNCTVDDTLIYRIIPASSRHFVLKHLVAGVDYNLCVLAIFDDAATSLAATHL
LGCAQFSTQEAYPDCHSLHAHFLGGTLTVIVGGIIVVTLLVFTVVMMVKYKFCGSAHSGM
PKVSNMYSQTNGGQPGVLNGMLPQRGPQRERGPKVQRRRARGKPARQEALERRTAEGVVA
CPGDLPELGTSKAKRSCSLDMGEISASACYGYAKRLSIMWTKRSQSVHGMLANCTAEGED
KRDGALASADELEESVV
Download sequence
Identical sequences K7F4Q3
ENSPSIP00000003013 ENSPSIP00000003013 XP_006129735.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]