SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004470 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004470
Domain Number 1 Region: 229-255,296-541
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.46e-70
Family Nuclear receptor ligand-binding domain 0.00000000158
Further Details:      
 
Domain Number 2 Region: 176-258
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-29
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004470   Gene: ENSPSIG00000004166   Transcript: ENSPSIT00000004495
Sequence length 588
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206637.1:3021375:3327524:1 gene:ENSPSIG00000004166 transcript:ENSPSIT00000004495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMTLHTKTSGVAMLHQIQGNELEPLNRPQLKIPLDRTLSEMYVESNKTGVFNYPEGTTY
DFATAAPVYSSTSLSYAPASESFGSSSLGGFHSLNNVPPSPVLFLQTTPQLSPFIHHHSQ
QVPYYLENDQSNFGMREAGPSTFYRPSSDNRRQGSRERMSSTSEKGSLSMESTKETRYCA
VCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCY
EVGMMKGGIRKDRRGGRMLKHKRQREEQDARSGGTASTEMRTPTLWTSPLVIKHSKKNSP
ALALTDDQMVSALLEAEPPIVYSEYDPNRPFSESSMMTLLTNLADRELVHMINWAKRVPG
FVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFD
MLLATSARFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLDEKDHIHRVLDKITDAL
IHLMAKSGLSPNQQHRRLAQLLLILSHFRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDA
HRLHARGSRNAPHVEEENQSQLTTASTSSHSLQPFYVSREDENLQTTI
Download sequence
Identical sequences K7F8W0
XP_006115036.1.96668 XP_006115037.1.96668 XP_014425000.1.96668 XP_014425001.1.96668 XP_014425002.1.96668 ENSPSIP00000004470 ENSPSIP00000004470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]