SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005268 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005268
Domain Number 1 Region: 191-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-83
Family Nuclear receptor ligand-binding domain 0.00000000371
Further Details:      
 
Domain Number 2 Region: 138-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-31
Family Nuclear receptor 0.00000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005268   Gene: ENSPSIG00000004871   Transcript: ENSPSIT00000005298
Sequence length 465
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206799.1:578365:614976:1 gene:ENSPSIG00000004871 transcript:ENSPSIT00000005298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYPHFIKFPAGFGNSPVHASSTSVGSSPSFSPGDAVNGHPSYIEAPANASRTRTSPM
NTLGSPALGSPYRVIASSIGPHSVSLASAPSMNFVAHTSPQLNIMNAVSSSEDIKPLPGL
PGIGNMNYASTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLVYTCRDN
KDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERSENEAESTCSSNEDMPVER
ILEAELAVEPKTESYSDVSTENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLMLEDQ
VILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKM
KDMQMDKSELGCLRAIVLFNPDAKGLSSPFEVESLREKVYATLEAYTKQKYPEQPGRFAK
LLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences K7FB58
XP_006115949.1.96668 ENSPSIP00000005268 ENSPSIP00000005268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]