SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005542 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005542
Domain Number 1 Region: 309-405
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 466-746
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.12e-18
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 42-110
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000402
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 231-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family I set domains 0.023
Further Details:      
 
Domain Number 5 Region: 155-227
Classification Level Classification E-value
Superfamily EF-hand 0.00000000173
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005542   Gene: ENSPSIG00000005140   Transcript: ENSPSIT00000005575
Sequence length 808
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206812.1:5864370:6427296:1 gene:ENSPSIG00000005140 transcript:ENSPSIT00000005575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESDGTRRLSVDAGRLQQKESRSFEVTRRKVLYGQDGLHASCEKKYCGRGSKCVVNKETN
QPECKCLEDCKPSYMPVCGSDGKFYENHCELHRASCLQRKKIYIIHSKDCFFKGDTCTMA
NYSRLKSILLDFQAHHHNQLGSPVEDRTFQKRLLVEDLFKYLDINSDRHLSSAELAQLMK
KEALEDDFLDCTLEDLLRFDDYNNDGYLTLQELYTAFQVVQLTLPEEQKVSITTVTVGLS
AVLTCAIHGTLRPPIIWKRNGVILNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHAYG
YEELYQTHILQVNVPPVIRVYPETQAQEPGVSASLKCHAEGIPNPRISWLKNGIDIMPKL
SKQLTLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTRLSVGNMF
YVFSNDGVTIIQPNECEIRRHIKPSERIFTSYEEICPRAEGEAAQSCLWASAVNVRDKYI
YVTQPKQNRLMIIDIQTQKVMQSIDVDPLPAKLHYDKSHDQVWVLSWGNMLKSHPTLQVI
TEASGGEIHHIIHTPFEDVDDFFIPPTNLIINHVRFGFVFNKSRSAVHKIDLETVTHIKT
ISFKNYSCKPQAMAYTHLGGYFFVQCKKNTSTVASPQLIIDSVTDSVIGPNSDISGTPYI
SPDGRYLVSAAEDSGRIKVQAITIQGEIKLMYDLQTNVHISDLTFQPSFTEGNQYYIYAT
SHLQTDVLFVELSTGKMNVLKNLKDPIMSKDWPWNSDNRIMKDSGLFGQYLITPAKDSLF
VINGRQNTLHCEVSGIKRGNTMVWVGEV
Download sequence
Identical sequences K7FBY2
ENSPSIP00000005542 ENSPSIP00000005542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]