SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005734 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005734
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 4.19e-37
Family Second domain of FERM 0.00000284
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-27
Family First domain of FERM 0.0000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005734   Gene: ENSPSIG00000005287   Transcript: ENSPSIT00000005768
Sequence length 881
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224666.1:1396521:1503292:1 gene:ENSPSIG00000005287 transcript:ENSPSIT00000005768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKDQDQDQQEAPAQQGTAGTQPQDQQQLSEEHQNAIDQFSAVAAHSTPVK
KEQVTEREQEFAAAAAKQLEYQQFEEDKLSQKSSCSKLSRSPLKIVKKPKNMQCKVTLLD
GSEYGCEVEKRSRGQILFDKVCEHLNLLEKDYFGLTYRDMENQKNWLDPAKEIKKQIRSG
AWQFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDEYGGDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEMYMKDSMSAAEVGTGQYATTKGIS
QTNLITTVTPEKKPEEERDEEEGKKKGEEITPVSAIRHDTKELDKNQEDLMKHQTNISEL
KRTFLETSTDTAVTNEWEKRLSTSPVRLATRHEEAPMIEPLVPEETKEEKEKSEKLIFLQ
KGSSTFLESQRTEATTGQQISAREMKQEIQSHQDAAKKVVQETVLVEERYMTNVHASGDA
VKLAGNLLDAMAQAVSAEASSITGKEGSAVTEGDKEKKREEADKAVAKQEEIAAASHLQE
EEQSATVHVSDTLERKPHFEQSPILKTETISFDSVSPGGEKLEISSKEVPVVHTETKTIT
YESSQTDSGADSEPGVLMSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDAD
IDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences K7FCH4
ENSPSIP00000005734 XP_006139076.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]