SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006063 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006063
Domain Number 1 Region: 175-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-77
Family Nuclear receptor ligand-binding domain 0.00000000163
Further Details:      
 
Domain Number 2 Region: 125-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.46e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006063   Gene: ENSPSIG00000005595   Transcript: ENSPSIT00000006098
Sequence length 458
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224636.1:1241106:1457800:1 gene:ENSPSIG00000005595 transcript:ENSPSIT00000006098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVELCLPESFSLHYEEELLCRMSSKDRHIDSSCSSYIKTEPSSPASLTDSINHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAAGLGGNGPVRKRYDDCSSTIAEDSQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences K7FDF3
ENSPSIP00000006063 XP_005288793.1.60341 XP_006137407.1.96668 XP_007064809.1.26238 ENSPSIP00000006063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]