SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006075 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006075
Domain Number 1 Region: 174-456
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-77
Family Nuclear receptor ligand-binding domain 0.00000000163
Further Details:      
 
Domain Number 2 Region: 124-201
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.46e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006075   Gene: ENSPSIG00000005595   Transcript: ENSPSIT00000006111
Sequence length 457
Comment pep:known_by_projection scaffold:PelSin_1.0:JH224636.1:1285760:1454361:1 gene:ENSPSIG00000005595 transcript:ENSPSIT00000006111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDKTLSCPYADYLHVEQELLCRMSSKDRHIDSSCSSYIKTEPSSPASLTDSINHHSPGGS
SDASGSYSSTMNGHQNGLDSPPLYPSAAGLGGNGPVRKRYDDCSSTIAEDSQTKCEYMLN
SMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQ
ACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHL
LVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLL
QSAWMEILILGVVYRSLSFEDELVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKL
EKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTL
PLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences K7FDG5
ENSPSIP00000006075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]