SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006087 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006087
Domain Number 1 Region: 222-461
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-70
Family Nuclear receptor ligand-binding domain 0.000000000426
Further Details:      
 
Domain Number 2 Region: 18-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-31
Family Nuclear receptor 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006087   Gene: ENSPSIG00000005579   Transcript: ENSPSIT00000006123
Sequence length 470
Comment pep:known scaffold:PelSin_1.0:JH224647.1:1019881:1077816:-1 gene:ENSPSIG00000005579 transcript:ENSPSIT00000006123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITSYTKNNPLSFSAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETGGTYSNGHVIDLPKSEGYYNVDSAQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMAEIDRIAQNIIKSHLETCQY
TMDELHQLAWQTHTYEEIKVYQNKTREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
VAKIPTITALCNLHGEKLQVFKQSHPDIVNTLFPPLYKELFNPDSTTGCK
Download sequence
Identical sequences K7FDH7
ENSPSIP00000006087 ENSPSIP00000006087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]