SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006293 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006293
Domain Number 1 Region: 232-449
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.96e-52
Family Nuclear receptor ligand-binding domain 0.00000000489
Further Details:      
 
Domain Number 2 Region: 108-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-27
Family Nuclear receptor 0.0000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006293   Gene: ENSPSIG00000005774   Transcript: ENSPSIT00000006330
Sequence length 450
Comment pep:known_by_projection scaffold:PelSin_1.0:JH209446.1:251336:304429:1 gene:ENSPSIG00000005774 transcript:ENSPSIT00000006330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEMMIFQDFPSVLTEAMSSPVQEPDVSPYTQYSNMPFPPVQPQISSPPYYSNLGFYPQQP
EEWYSPGMYELRRIPCENFFTRETELGDIPVAKKSRMGHSTGRVKGEELCVVCGDKASGY
HYNALTCEGCKGFFRRSITKNAVYKCKNGGNCEMDMYMRRKCQECRLRKCKQMGMLAECM
YTGLLTEIQCKSKRLRKNVKQMPDQPANEDTEGTDLKQVTSTTKIYREKVELTPEQQNLL
HYIMDSYSKHRIPQEVSKKLLQEEFSAEENFLILTEMATSHVQVLVEFTKRLPGFQTLDH
EDQMVRSAEIFNKKLPSGHADLLEERIRRSGISDDFITPMFSFYKSIGELKMTEEEYALL
TAIVILSPDKLDRQYIKDRESVERLQEPLLEVLQKLCKLHHTDNPQHFACLLGRLTELRT
FNHNHAEMLMSWRVNDHKFTPLLCEIWDVQ
Download sequence
Identical sequences K7FE33
ENSPSIP00000006293 ENSPSIP00000006293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]