SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006296 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006296
Domain Number 1 Region: 261-453
Classification Level Classification E-value
Superfamily Nudix 6.09e-44
Family NADH pyrophosphatase 0.0012
Further Details:      
 
Domain Number 2 Region: 14-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.37e-18
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006296   Gene: ENSPSIG00000005800   Transcript: ENSPSIT00000006333
Sequence length 459
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206819.1:396733:419593:1 gene:ENSPSIG00000005800 transcript:ENSPSIT00000006333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNTERSPKQQMISQLHNFAATGDKVRLTALCSQSPSLINEAAENGWTALMYAARNGRFE
IVQILLEKGCDRSIVNKSSQTALDIAKFWGYKHIANLLENVKGGQKPFFLPNYVREYENY
FSRTLLDRRSDKRTDSKWLNRKQNHPATIYILFSNLSPLVTLGGGEDSYQQPEVRLCRLC
HKDVKEYMSQTEEVTLIFLGVELQLASLNGRVLKEDEDDGLVAWFALSIDATFAEQFKQK
HEDCYFLHPPMPALLQLPEREAGIVAQARSVLAWHNRYQFCPTCGSSTKIEEGGYKKTCL
KEDCPSLQGVHNTSYPRIDPVVIMQVLHPDGNQCLLGRQKRFPPGLFTCLAGFVEPGETI
EDAVRREVEEESGVKIGHVQYVSCQPWPMPSSLMIGCLAVAISTEIRVDKNEIEDARWFT
REQVVDVLIKGNQHSFLVPPSQAIAHQLIKHWIGMNANL
Download sequence
Identical sequences K7FE36
ENSPSIP00000006296 ENSPSIP00000006296 XP_006116180.1.96668 XP_006116181.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]