SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006397 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006397
Domain Number 1 Region: 176-440
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-85
Family Nuclear receptor ligand-binding domain 0.000000000478
Further Details:      
 
Domain Number 2 Region: 71-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.87e-27
Family Nuclear receptor 0.0000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006397   Gene: ENSPSIG00000005889   Transcript: ENSPSIT00000006434
Sequence length 441
Comment pep:known_by_projection scaffold:PelSin_1.0:JH206760.1:4506404:4518322:1 gene:ENSPSIG00000005889 transcript:ENSPSIT00000006434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPPKEIPAIKEEEEKEEAVIEAGESSDPSGGPDRLPPSGSYTDLSQSSSPSLSDQLQM
GGEETSSASLNVECRVCGDIASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRNCKIQRK
NRNKCQYCRFQKCLSLGMSHNAIRFGRMPEAEKRKLVAGLTASEDSCHNPQVADLKAFSK
HIHDAYLKTFNMTKKKARGILTGKTGSTPPFVIHDMDTLWQAEKGLVWKQLVNGIPPYKE
IGVHVFYRCQCTTVETVRELTEFAKTIPSFLSLYLNDQVTLLKYGVHEAIFAMLASIMNK
DGLLVANGNGFVTREFLRSLRKPFNEIMEPKFEFAVKFNALELDDSDLSLFVAAIILCGD
RPGLMDVKQVEEIQDNVLQALDFHLQSNHPDAQYLFPKLLQKMADLRQLVTEHAQLVQKI
KKTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences K7FEC7
ENSPSIP00000006387 ENSPSIP00000006397 ENSPSIP00000006387 XP_006115720.1.96668 XP_006115722.1.96668 XP_006115724.1.96668 XP_014425307.1.96668 XP_014425308.1.96668 XP_014425309.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]