SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006582 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006582
Domain Number 1 Region: 167-377
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.02e-56
Family Nuclear receptor ligand-binding domain 0.0000224
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-26
Family Nuclear receptor 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006582   Gene: ENSPSIG00000006035   Transcript: ENSPSIT00000006619
Sequence length 378
Comment pep:known_by_projection scaffold:PelSin_1.0:JH208873.1:1107481:1131803:1 gene:ENSPSIG00000006035 transcript:ENSPSIT00000006619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQCRAC
RLKKCLEVNMNKDGICTQPLPTSPPPSPLGCVVGTYSGKPRLAMRAPRNIPSQLPAEFPS
SSPVPAARATGHNYLCTGMTSEVEAYLRRKISGVAWDTGSQYPHEVNGTPMYLYEVATES
VCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLA
VSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSE
LRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFK
KTIGNVPITRLLSDMYKS
Download sequence
Identical sequences K7FEX2
ENSPSIP00000006582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]