SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007055 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007055
Domain Number 1 Region: 743-989
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-63
Family Nuclear receptor ligand-binding domain 0.0000000589
Further Details:      
 
Domain Number 2 Region: 603-687
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.1e-24
Family Nuclear receptor 0.0000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007055   Gene: ENSPSIG00000006383   Transcript: ENSPSIT00000007096
Sequence length 991
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211920.1:1320216:1566882:-1 gene:ENSPSIG00000006383 transcript:ENSPSIT00000007096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYYSCPEGLDMEKRWGQVSQSVQYSSGAGEQTDESNYMEIVNVSCVSGAFPNSNAQ
GNSKEKPELLPSLQQDNNQPGILNSDIKSESDSKELSATVAESMGLYMDSIRDADFTYDQ
QNQQGSISPGKTYQNVEQLVKLYKENGHCASPLNSANRPLRSLVSDSGNSMNGGLIHTIV
KSPVTCPERAPSGCSPQRMTSVCSPAGFNCVSSTTSTNFVNFPVHSPISQGTPLSCSPNI
ENRGSRLHSPAHVSNVGSPLSSPISSMKSPISSPPSHCSVKSPVSSPNNVTMRSSVSSPA
NMNSRCSIASPSNTNNRSSLSSPAVSTVGSSICSPVNNALSFPASGTPSGPNTGQDTIPS
PETKDKGAQEITFPKMENAISNNCVAGQMNLVQFIKPDPDGAFSTSCVGENSKINSDSPF
SVPVKQESTKHSCSGVSFKGNQGVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVSSFDVN
CESSGFPNPGLSVGIKQEPNDGSYFQESSMPSSAIVGVNSGGQSFHYRIGAQGTISLSRP
LAREQTFQHVSSFPPVGTLVETWKSHSDLSSRRNDGYPVLEYIPENVSSSSLRSVSTGSS
RPSKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGKCSWQHNYLCAGRNDCIIDKIRRK
NCPACRLQKCLQAGMNLGARKSKKLGKLKGMHEEQQQQQQQQQQQPPPQSPEEGTTYIAP
VKEPSVNTALVPHLSAISPALAPSPIMILESIEPEIVYAGYDNSKPDTAEHLLSTLNRLA
GKQMVQVVKWAKILPGFRNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDL
VFNEERMRQSAMFELCQGMHQISLQFVRLQISFEEYTIMKVLLLLSTVPKDGLKSQAAFE
EMRANYIKELRKMVTKCPSNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALK
VEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Download sequence
Identical sequences K7FG95
ENSPSIP00000007055 XP_014434420.1.96668 ENSPSIP00000007055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]