SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008474 from Pelodiscus sinensis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008474
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-99
Family Protein kinases, catalytic subunit 0.0000000000482
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-24
Family Pleckstrin-homology domain (PH domain) 0.000000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008474   Gene: ENSPSIG00000007672   Transcript: ENSPSIT00000008518
Sequence length 480
Comment pep:known_by_projection scaffold:PelSin_1.0:JH211376.1:632069:733739:-1 gene:ENSPSIG00000007672 transcript:ENSPSIT00000008518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQTVADSLKKQEEEMMDF
RSGSPSDNSGAEEMEVSMTKPKHKVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGPDDAKEIMQHKFFSGIVWQDVYEKK
LVPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMDCVDNERRPHFPQFSYSASGTT
Download sequence
Identical sequences K7FKB4
ENSPSIP00000008474 XP_006132483.1.96668 ENSPSIP00000008474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]